NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1237937983|ref|NP_001341848|]
View 

protein patched homolog 1 isoform 9 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Patched super family cl25655
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
2-183 4.13e-121

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


The actual alignment was detected with superfamily member TIGR00918:

Pssm-ID: 355433  Cd Length: 1145  Bit Score: 368.05  E-value: 4.13e-121
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983    2 GKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKI 81
Cdd:TIGR00918   28 GKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIETNVEQLWVEVGGRVSQELAYTRQKI 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983   82 GEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCL 161
Cdd:TIGR00918  108 GEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCL 187
                          170       180
                   ....*....|....*....|..
gi 1237937983  162 IITPLDCFWEGAKLQSGTAYLL 183
Cdd:TIGR00918  188 IITPLDCFWEGAKLQGGTAYLP 209
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
2-183 4.13e-121

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 368.05  E-value: 4.13e-121
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983    2 GKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKI 81
Cdd:TIGR00918   28 GKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIETNVEQLWVEVGGRVSQELAYTRQKI 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983   82 GEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCL 161
Cdd:TIGR00918  108 GEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCL 187
                          170       180
                   ....*....|....*....|..
gi 1237937983  162 IITPLDCFWEGAKLQSGTAYLL 183
Cdd:TIGR00918  188 IITPLDCFWEGAKLQGGTAYLP 209
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
2-183 4.13e-121

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 368.05  E-value: 4.13e-121
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983    2 GKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKI 81
Cdd:TIGR00918   28 GKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIETNVEQLWVEVGGRVSQELAYTRQKI 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983   82 GEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCL 161
Cdd:TIGR00918  108 GEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCL 187
                          170       180
                   ....*....|....*....|..
gi 1237937983  162 IITPLDCFWEGAKLQSGTAYLL 183
Cdd:TIGR00918  188 IITPLDCFWEGAKLQGGTAYLP 209
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
18-140 2.94e-04

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 40.66  E-value: 2.94e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1237937983   18 QRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGeeAMFN-PQLMIQTP 96
Cdd:TIGR00917  310 ARFFGKYGIWVARHPTLVICLSVSVVLLLCVGLIRFKVETRPVKLWVAPGSRAALEKQYFDTHFG--PFYRiEQLIIATV 387
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 1237937983   97 K----EEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKS 140
Cdd:TIGR00917  388 QtsshEKAPEILTDDNLKLLFDIQKKVSQLFANYEGELITLDSPCFKP 435
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH