NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1238280186|ref|NP_001341890|]
View 

fibroblast growth factor 1 isoform 2 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FGF super family cl00060
Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or ...
25-57 2.94e-11

Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family plays essential roles in patterning and differentiation during vertebrate embryogenesis, and has neurotrophic activities. FGFs have a high affinity for heparan sulfate proteoglycans and require heparan sulfate to activate one of four cell surface FGF receptors. Upon binding to FGF, the receptors dimerize and their intracellular tyrosine kinase domains become active. FGFs have internal pseudo-threefold symmetry (beta-trefoil topology).


The actual alignment was detected with superfamily member pfam00167:

Pssm-ID: 350881  Cd Length: 123  Bit Score: 53.71  E-value: 2.94e-11
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1238280186  25 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHT 57
Cdd:pfam00167   1 RVRRLYCRTGGFHLQILPDGKVDGTGEDGSPYS 33
 
Name Accession Description Interval E-value
FGF pfam00167
Fibroblast growth factor; Fibroblast growth factors are a family of proteins involved in ...
25-57 2.94e-11

Fibroblast growth factor; Fibroblast growth factors are a family of proteins involved in growth and differentiation in a wide range of contexts. They are found in a wide range of organisms, from nematodes to humans. Most share an internal core region of high similarity, conserved residues in which are involved in binding with their receptors. On binding, they cause dimerization of their tyrosine kinase receptors leading to intracellular signalling. There are currently four known tyrosine kinase receptors for fibroblast growth factors. These receptors can each bind several different members of this family. Members of this family have a beta trefoil structure. Most have N-terminal signal peptides and are secreted. A few lack signal sequences but are secreted anyway; still others also lack the signal peptide but are found on the cell surface and within the extracellular matrix. A third group remain intracellular. They have central roles in development, regulating cell proliferation, migration and differentiation. On the other hand, they are important in tissue repair following injury in adult organisms.


Pssm-ID: 333894  Cd Length: 123  Bit Score: 53.71  E-value: 2.94e-11
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1238280186  25 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHT 57
Cdd:pfam00167   1 RVRRLYCRTGGFHLQILPDGKVDGTGEDGSPYS 33
FGF cd00058
Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or ...
29-58 9.03e-10

Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family plays essential roles in patterning and differentiation during vertebrate embryogenesis, and has neurotrophic activities. FGFs have a high affinity for heparan sulfate proteoglycans and require heparan sulfate to activate one of four cell surface FGF receptors. Upon binding to FGF, the receptors dimerize and their intracellular tyrosine kinase domains become active. FGFs have internal pseudo-threefold symmetry (beta-trefoil topology).


Pssm-ID: 238015  Cd Length: 123  Bit Score: 49.92  E-value: 9.03e-10
                          10        20        30
                  ....*....|....*....|....*....|
gi 1238280186  29 LYCsNGGHFLRILPDGTVDGTRDRSDQHTD 58
Cdd:cd00058     3 LYC-RTGFHLQILPDGTVDGTRDDSSSYTI 31
FGF smart00442
Acidic and basic fibroblast growth factor family; Mitogens that stimulate growth or ...
23-58 1.14e-09

Acidic and basic fibroblast growth factor family; Mitogens that stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family play essential roles in patterning and differentiation during vertebrate embryogenesis, and have neurotrophic activities.


Pssm-ID: 214665  Cd Length: 126  Bit Score: 49.57  E-value: 1.14e-09
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 1238280186   23 YKKPKLLYCSNGGHfLRILPDGTVDGTRDRSDQHTD 58
Cdd:smart00442   1 TKRLRQLYCRNGQH-LQILPDGTVDGTRDESSSFTI 35
 
Name Accession Description Interval E-value
FGF pfam00167
Fibroblast growth factor; Fibroblast growth factors are a family of proteins involved in ...
25-57 2.94e-11

Fibroblast growth factor; Fibroblast growth factors are a family of proteins involved in growth and differentiation in a wide range of contexts. They are found in a wide range of organisms, from nematodes to humans. Most share an internal core region of high similarity, conserved residues in which are involved in binding with their receptors. On binding, they cause dimerization of their tyrosine kinase receptors leading to intracellular signalling. There are currently four known tyrosine kinase receptors for fibroblast growth factors. These receptors can each bind several different members of this family. Members of this family have a beta trefoil structure. Most have N-terminal signal peptides and are secreted. A few lack signal sequences but are secreted anyway; still others also lack the signal peptide but are found on the cell surface and within the extracellular matrix. A third group remain intracellular. They have central roles in development, regulating cell proliferation, migration and differentiation. On the other hand, they are important in tissue repair following injury in adult organisms.


Pssm-ID: 333894  Cd Length: 123  Bit Score: 53.71  E-value: 2.94e-11
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1238280186  25 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHT 57
Cdd:pfam00167   1 RVRRLYCRTGGFHLQILPDGKVDGTGEDGSPYS 33
FGF cd00058
Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or ...
29-58 9.03e-10

Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family plays essential roles in patterning and differentiation during vertebrate embryogenesis, and has neurotrophic activities. FGFs have a high affinity for heparan sulfate proteoglycans and require heparan sulfate to activate one of four cell surface FGF receptors. Upon binding to FGF, the receptors dimerize and their intracellular tyrosine kinase domains become active. FGFs have internal pseudo-threefold symmetry (beta-trefoil topology).


Pssm-ID: 238015  Cd Length: 123  Bit Score: 49.92  E-value: 9.03e-10
                          10        20        30
                  ....*....|....*....|....*....|
gi 1238280186  29 LYCsNGGHFLRILPDGTVDGTRDRSDQHTD 58
Cdd:cd00058     3 LYC-RTGFHLQILPDGTVDGTRDDSSSYTI 31
FGF smart00442
Acidic and basic fibroblast growth factor family; Mitogens that stimulate growth or ...
23-58 1.14e-09

Acidic and basic fibroblast growth factor family; Mitogens that stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family play essential roles in patterning and differentiation during vertebrate embryogenesis, and have neurotrophic activities.


Pssm-ID: 214665  Cd Length: 126  Bit Score: 49.57  E-value: 1.14e-09
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 1238280186   23 YKKPKLLYCSNGGHfLRILPDGTVDGTRDRSDQHTD 58
Cdd:smart00442   1 TKRLRQLYCRNGQH-LQILPDGTVDGTRDESSSFTI 35
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH