NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1242862604|ref|NP_001342314|]
View 

FK506-binding protein 15 isoform 2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
192-285 4.33e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


:

Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 4.33e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 271
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 1242862604  272 TQPTDSILVFEVEV 285
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
556-915 9.43e-19

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 92.47  E-value: 9.43e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  556 METSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtQAKVTEELAA 635
Cdd:COG1196    705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEA-LAKLKEEIEE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  636 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 715
Cdd:COG1196    784 LEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKE 863
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  716 ELTDLRAEKTSLEKNLS----ERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL---AQAE 788
Cdd:COG1196    864 ELEELEAEKEELEDELKeleeEKEELEEELR-ELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELeeeYEDT 942
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  789 LQSQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmQRLEKTKSQApa 862
Cdd:COG1196    943 LETELEREIERLEEEIEAlgpvnlRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKR--ERFKETFDKI-- 1018
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  863 graaadpSEKVKKIMNQVFQSLRGEFELEES---YDGGTILRtIMHTIK-MVTLQLL 915
Cdd:COG1196   1019 -------NENFSEIFKELFGGGTAELELTEPddpLTAGIEIS-ARPPGKkLQSLSLL 1067
PHA03247 super family cl33720
large tegument protein UL36; Provisional
934-1119 1.39e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.47  E-value: 1.39e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  934 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 1013
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604 1014 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 1091
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1242862604 1092 PalDPESQGGEAQPPECKQAEDVSSS-GP 1119
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
PHA03247 super family cl33720
large tegument protein UL36; Provisional
302-495 9.06e-03

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 9.06e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  302 SSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGlrskSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQ- 380
Cdd:PHA03247  2607 DPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHP----PPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQr 2682
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  381 ----------------LDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPqmASQAPQPSGSGLQTPSAALMQAvs 444
Cdd:PHA03247  2683 prrraarptvgsltslADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALP--AAPAPPAVPAGPATPGGPARPA-- 2758
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1242862604  445 ldSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPH 495
Cdd:PHA03247  2759 --RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADP 2807
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
192-285 4.33e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 4.33e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 271
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 1242862604  272 TQPTDSILVFEVEV 285
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
556-915 9.43e-19

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 92.47  E-value: 9.43e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  556 METSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtQAKVTEELAA 635
Cdd:COG1196    705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEA-LAKLKEEIEE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  636 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 715
Cdd:COG1196    784 LEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKE 863
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  716 ELTDLRAEKTSLEKNLS----ERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL---AQAE 788
Cdd:COG1196    864 ELEELEAEKEELEDELKeleeEKEELEEELR-ELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELeeeYEDT 942
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  789 LQSQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmQRLEKTKSQApa 862
Cdd:COG1196    943 LETELEREIERLEEEIEAlgpvnlRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKR--ERFKETFDKI-- 1018
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  863 graaadpSEKVKKIMNQVFQSLRGEFELEES---YDGGTILRtIMHTIK-MVTLQLL 915
Cdd:COG1196   1019 -------NENFSEIFKELFGGGTAELELTEPddpLTAGIEIS-ARPPGKkLQSLSLL 1067
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
183-289 5.54e-18

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619 [Multi-domain]  Cd Length: 205  Bit Score: 83.62  E-value: 5.54e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  183 QDLVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGsgKVVKGLEDGLLGMKKGGKRLIITPSACA 262
Cdd:COG0545    106 KVLKAGDGAAPKKGDTVTVHYTGTLID----GTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELA 179
                           90       100
                   ....*....|....*....|....*..
gi 1242862604  263 AGSEGVIGwTQPTDSILVFEVEVRRVK 289
Cdd:COG0545    180 YGERGVPG-VIPPNSTLVFEVELLDVK 205
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
564-857 3.71e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 74.32  E-value: 3.71e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  564 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATEntqakVTEELAAATAQVSHL 643
Cdd:TIGR02168  699 ALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTE-----LEAEIEELEERLEEA 773
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  644 QLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEK--------------QSRRQLELK 709
Cdd:TIGR02168  774 EEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLErriaaterrledleEQIEELSED 853
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  710 VTSLEEELTDLRAEKTSLEKNL---SERKKKSAQERCQAEAEMDEIR---KSHQEELDRLRQLLKKARvstdqAAAEQLT 783
Cdd:TIGR02168  854 IESLAAEIEELEELIEELESELealLNERASLEEALALLRSELEELSeelRELESKRSELRRELEELR-----EKLAQLE 928
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  784 LAQAELQSQWEAKCEQLLASAR---DEHLQQYREVCAQRDAHQQKLALLQDECLAL----QAQIAAFTEQKEHMQRLEKT 856
Cdd:TIGR02168  929 LRLEGLEVRIDNLQERLSEEYSltlEEAEALENKIEDDEEEARRRLKRLENKIKELgpvnLAAIEEYEELKERYDFLTAQ 1008

                   .
gi 1242862604  857 K 857
Cdd:TIGR02168 1009 K 1009
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
598-1017 9.82e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 62.62  E-value: 9.82e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  598 ERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTR 677
Cdd:NF033930    75 DEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVP 154
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  678 LQADLSELREASEQTQTKfksEKQSRRQLELKVTSLEEELTDLRAEKTSLEKnlsERKKKSAQERCQAEAEmdeirkshq 757
Cdd:NF033930   155 EAEELAETKKKAEEAKAE---EPVAKKKVDEAKKKVEEAKKKVEAEEAEIEK---LQNEEVALEAKIAELE--------- 219
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  758 EELDRLRQLLKKARVSTDQAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLAL 828
Cdd:NF033930   220 NQVDNLEKELAEIDESDSEDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEE 292
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  829 LQDECLALQAQIAAFTEQKEHMQRLEktKSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIK 908
Cdd:NF033930   293 LSKKIDELDNEVAKLEKEVSDLENSD--NNVADYYKEALEKDLATKKA------------ELEK-------------TQK 345
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  909 MVTlQLLNHQEEEEEEEEEEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTP 984
Cdd:NF033930   346 DLD-KALNELGPDGDEEETPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKA 423
                          410       420       430
                   ....*....|....*....|....*....|...
gi 1242862604  985 EngaqtrkgEPAEAEVPSeikdsslPPQPAGIP 1017
Cdd:NF033930   424 E--------KPAPAPAPK-------PEQPAPAP 441
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
570-859 1.33e-09

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 61.63  E-value: 1.33e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  570 QENERLKQELL---------EKSSRIE-------------EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA 627
Cdd:pfam15742   13 EEVQQLRQDLHrlqilcssaERELRYEreknldlkqhnslLQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQ 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  628 KVTE-ELAAATAQVSHLQL------------KMTAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQT 692
Cdd:pfam15742   91 KIRElELEVLKQAQSIKSQnslqeklaqeksKVAEAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKL 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  693 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarv 772
Cdd:pfam15742  171 KQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS---- 244
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  773 stdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQ 851
Cdd:pfam15742  245 -------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQ 315

                   ....*...
gi 1242862604  852 RLEKTKSQ 859
Cdd:pfam15742  316 SQIEKEKA 323
PRK11281 PRK11281
mechanosensitive channel MscK;
616-869 1.22e-08

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 59.54  E-value: 1.22e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  616 NSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQT 694
Cdd:PRK11281    43 AQLDALNKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEET 114
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  695 KFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQaeAEMDEirksHQEELDRLRQLLKKARVST 774
Cdd:PRK11281   115 RETLSTLSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQ--AALYA----NSQRLQQIRNLLKGGKVGG 186
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  775 DQAAAEQLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEH 849
Cdd:PRK11281   187 KALRPSQRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKT 261
                          250       260
                   ....*....|....*....|
gi 1242862604  850 MQRLEktkSQAPAGRAAADP 869
Cdd:PRK11281   262 VQEAQ---SQDEAARIQANP 278
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
547-742 5.78e-06

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 50.39  E-value: 5.78e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  547 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLqtATENTQ 626
Cdd:NF038025    23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDEL--ATEANK 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  627 AKVteELAAATAQVSHLQLKMTAHQKKETELqlqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkfksEKQSRRQ- 705
Cdd:NF038025    92 ASA--ELDEVNAEIQGVKEEIKEKQEQLMVL------DTKE-------------ELDELSE-----------EELAERQe 139
                          170       180       190
                   ....*....|....*....|....*....|....*..
gi 1242862604  706 LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 742
Cdd:NF038025   140 LEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
PHA03247 PHA03247
large tegument protein UL36; Provisional
934-1119 1.39e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.47  E-value: 1.39e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  934 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 1013
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604 1014 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 1091
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1242862604 1092 PalDPESQGGEAQPPECKQAEDVSSS-GP 1119
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
PRK11570 PRK11570
peptidyl-prolyl cis-trans isomerase; Provisional
185-285 9.08e-04

peptidyl-prolyl cis-trans isomerase; Provisional


Pssm-ID: 183207  Cd Length: 206  Bit Score: 42.09  E-value: 9.08e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  185 LVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSgkVVKGLEDGLLGMKKGGKRLIITPSACAAG 264
Cdd:PRK11570   109 LTQGEGAIPARTDRVRVHYTGKLID----GTVFDSSVARGEPAEFPVNG--VIPGWIEALTLMPVGSKWELTIPHELAYG 182
                           90       100
                   ....*....|....*....|.
gi 1242862604  265 SEGViGWTQPTDSILVFEVEV 285
Cdd:PRK11570   183 ERGA-GASIPPFSTLVFEVEL 202
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
561-989 1.35e-03

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 42.69  E-value: 1.35e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  561 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLqtaTENTQAKVTEELAAATA 638
Cdd:NF033838    63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAEL---TSKTKKELDAAFEQFKK 132
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  639 QVSHLQLKMTAHQKKETELQLQLTDNlKETDLlRGHVT----RLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLE 714
Cdd:NF033838   133 DTLEPGKKVAEATKKVEEAEKKAKDQ-KEEDR-RNYPTntykTLELEIAESDVEVKKAELELVKEEAKEPRDEEKIKQAK 210
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  715 EELTDLRAEKTSLEKNLSERKK--KSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARV--------------STDQAA 778
Cdd:NF033838   211 AKVESKKAEATRLEKIKTDREKaeEEAKRRADAKLKEAVEKNVATSEQDKPKRRAKRGVLgepatpdkkendakSSDSSV 290
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  779 AEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRLEKTKS 858
Cdd:NF033838   291 GEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAELELVKE 360
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  859 QAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKKPL--- 935
Cdd:NF033838   361 EAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQPApap 426
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1242862604  936 RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 989
Cdd:NF033838   427 QPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
675-876 1.90e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 42.57  E-value: 1.90e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  675 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 744
Cdd:NF033441   928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  745 AEAEMDEI-------RKSHQ--EELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 815
Cdd:NF033441  1005 AIEELRSIladpdpySRIPDlpPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1242862604  816 CAQRDAHQQKLALLQDeclaLQAQIA--AFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 876
Cdd:NF033441  1082 LKERIEPEVSIASLRA----LLDQLAdaLLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
PHA03247 PHA03247
large tegument protein UL36; Provisional
302-495 9.06e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 9.06e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  302 SSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGlrskSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQ- 380
Cdd:PHA03247  2607 DPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHP----PPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQr 2682
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  381 ----------------LDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPqmASQAPQPSGSGLQTPSAALMQAvs 444
Cdd:PHA03247  2683 prrraarptvgsltslADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALP--AAPAPPAVPAGPATPGGPARPA-- 2758
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1242862604  445 ldSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPH 495
Cdd:PHA03247  2759 --RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADP 2807
F-BAR_GAS7 cd07649
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein ...
579-825 9.54e-03

The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7; F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Growth Arrest Specific protein 7 (GAS7) is mainly expressed in the brain and is required for neurite outgrowth. It may also play a role in the protection and migration of embryonic stem cells. Treatment-related acute myeloid leukemia (AML) has been reported resulting from mixed-lineage leukemia (MLL)-GAS7 translocations as a complication of primary cancer treatment. GAS7 contains an N-terminal SH3 domain, followed by a WW domain, and a central F-BAR domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.


Pssm-ID: 153333 [Multi-domain]  Cd Length: 233  Bit Score: 39.23  E-value: 9.54e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  579 LLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEK-RNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETEL 657
Cdd:cd07649     10 LLQKQLKGKQMQKEMAEFIRERIKIEEEYAKNLSKlSQSSLAAQEEGTLGEAWAQVKKSLADEAEVHLKFSSKLQSEVEK 89
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  658 QL--QLTDNLKETDLLRGHVTRLQADLSeLREASEQTQTKFKSEKQsrRQLELKVTSLEEELTDLRaektslEKNLSERK 735
Cdd:cd07649     90 PLlnFRENFKKDMKKLDHHIADLRKQLA-SRYAAVEKARKALLERQ--KDLEGKTQQLEIKLSNKT------EEDIKKAR 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  736 KKSAQercqaeaemdeirksHQEELDRLRQLLKKARvstdQAAAEQLTLAQAELQSQWEAKCEQLlasarDEHLQQYREV 815
Cdd:cd07649    161 RKSTQ---------------AGDDLMRCVDLYNQAQ----SKWFEEMVTTSLELERLEVERIEMI-----RQHLCQYTQL 216
                          250
                   ....*....|
gi 1242862604  816 CAQRDAHQQK 825
Cdd:cd07649    217 RHETDMFNQS 226
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
192-285 4.33e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 4.33e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 271
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 1242862604  272 TQPTDSILVFEVEV 285
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
556-915 9.43e-19

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 92.47  E-value: 9.43e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  556 METSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtQAKVTEELAA 635
Cdd:COG1196    705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEA-LAKLKEEIEE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  636 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 715
Cdd:COG1196    784 LEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKE 863
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  716 ELTDLRAEKTSLEKNLS----ERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL---AQAE 788
Cdd:COG1196    864 ELEELEAEKEELEDELKeleeEKEELEEELR-ELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELeeeYEDT 942
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  789 LQSQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmQRLEKTKSQApa 862
Cdd:COG1196    943 LETELEREIERLEEEIEAlgpvnlRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKR--ERFKETFDKI-- 1018
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  863 graaadpSEKVKKIMNQVFQSLRGEFELEES---YDGGTILRtIMHTIK-MVTLQLL 915
Cdd:COG1196   1019 -------NENFSEIFKELFGGGTAELELTEPddpLTAGIEIS-ARPPGKkLQSLSLL 1067
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
183-289 5.54e-18

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619 [Multi-domain]  Cd Length: 205  Bit Score: 83.62  E-value: 5.54e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  183 QDLVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGsgKVVKGLEDGLLGMKKGGKRLIITPSACA 262
Cdd:COG0545    106 KVLKAGDGAAPKKGDTVTVHYTGTLID----GTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELA 179
                           90       100
                   ....*....|....*....|....*..
gi 1242862604  263 AGSEGVIGwTQPTDSILVFEVEVRRVK 289
Cdd:COG0545    180 YGERGVPG-VIPPNSTLVFEVELLDVK 205
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
562-859 6.00e-15

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 80.14  E-value: 6.00e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  562 MSNIQRIiQENERLKQELLEkssRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQT---ATENTQAKVTEELAAATA 638
Cdd:COG1196    178 ERKLERT-EENLERLEDLLE---ELEKQLEKLERQAEKAERYQELKAELRELELALLLAklkELRKELEELEEELSRLEE 253
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  639 QVSHLQLKMtahQKKETELQlQLTDNLKEtdlLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELT 718
Cdd:COG1196    254 ELEELQEEL---EEAEKEIE-ELKSELEE---LREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERLE 326
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  719 DLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLL--KKARVSTDQAAAE-QLTLAQAELQSQweA 795
Cdd:COG1196    327 ELKEKIEALKEELEERETLLEELE-QLLAELEEAKEELEEKLSALLEELeeLFEALREELAELEaELAEIRNELEEL--K 403
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1242862604  796 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQ 859
Cdd:COG1196    404 REIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRdRLKELERE 468
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
564-857 3.71e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 74.32  E-value: 3.71e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  564 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATEntqakVTEELAAATAQVSHL 643
Cdd:TIGR02168  699 ALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTE-----LEAEIEELEERLEEA 773
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  644 QLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEK--------------QSRRQLELK 709
Cdd:TIGR02168  774 EEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLErriaaterrledleEQIEELSED 853
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  710 VTSLEEELTDLRAEKTSLEKNL---SERKKKSAQERCQAEAEMDEIR---KSHQEELDRLRQLLKKARvstdqAAAEQLT 783
Cdd:TIGR02168  854 IESLAAEIEELEELIEELESELealLNERASLEEALALLRSELEELSeelRELESKRSELRRELEELR-----EKLAQLE 928
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  784 LAQAELQSQWEAKCEQLLASAR---DEHLQQYREVCAQRDAHQQKLALLQDECLAL----QAQIAAFTEQKEHMQRLEKT 856
Cdd:TIGR02168  929 LRLEGLEVRIDNLQERLSEEYSltlEEAEALENKIEDDEEEARRRLKRLENKIKELgpvnLAAIEEYEELKERYDFLTAQ 1008

                   .
gi 1242862604  857 K 857
Cdd:TIGR02168 1009 K 1009
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
531-847 4.37e-13

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 73.95  E-value: 4.37e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  531 LMTKVEELQKHSSgnsMLLPSMSV-TMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNL 609
Cdd:TIGR02169  693 LQSELRRIENRLD---ELSQELSDaSRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEE 769
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  610 MMEKRNNsLQTATENTQA--------KVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQAD 681
Cdd:TIGR02169  770 LEEDLHK-LEEALNDLEArlshsripEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQ 848
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  682 LSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaqeRCQAEAEMDEIRKsHQEELD 761
Cdd:TIGR02169  849 IKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERK----IEELEAQIEKKRK-RLSELK 923
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  762 RLRQLLKKARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECL 834
Cdd:TIGR02169  924 AKLEALEEELSEIEDPKGEDEEIPEEELSlEDVQAELQRVEEEIRAlepvnmLAIQEYEEVLKRLDELKEKRAKLEEERK 1003
                          330
                   ....*....|...
gi 1242862604  835 ALQAQIAAFTEQK 847
Cdd:TIGR02169 1004 AILERIEEYEKKK 1016
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
561-856 1.43e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 72.44  E-value: 1.43e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  561 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmekrnnslQTATENTQAKVTEELAAATAQV 640
Cdd:COG1196    244 LEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEE------------LLELKEEIEELEGEISLLRERL 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  641 SHLQLKMTAHQKKETELQLQLTD---NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSrrqlelKVTSLEEEL 717
Cdd:COG1196    312 EELENELEELEERLEELKEKIEAlkeELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEE------LFEALREEL 385
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  718 TDLRAEKTSLEKNLSErkkksaqercqAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQsqwEAKC 797
Cdd:COG1196    386 AELEAELAEIRNELEE-----------LKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEE---LEEL 451
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1242862604  798 EQLLASARDEHLQQYREVCAQRDAHQQKLALLQD---ECLALQAQIAAFTEQKEHMQRLEKT 856
Cdd:COG1196    452 EEQLEELRDRLKELERELAELQEELQRLEKELSSleaRLDRLEAEQRASQGVRAVLEALESG 513
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
576-860 2.23e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 71.63  E-value: 2.23e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  576 KQELLEKSSRIEEQNDKISDLIERnqryveqsnlmMEKRNNSLQTatentQAKVTEELAAATAQVSHLQL-----KMTAH 650
Cdd:TIGR02168  174 RKETERKLERTRENLDRLEDILNE-----------LERQLKSLER-----QAEKAERYKELKAELRELELallvlRLEEL 237
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  651 QKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-------EASEQTQTKFKS--------------EKQSRRQLELK 709
Cdd:TIGR02168  238 REELEELQEELKEAEEELEELTAELQELEEKLEELRlevseleEEIEELQKELYAlaneisrleqqkqiLRERLANLERQ 317
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  710 VTSLEEELTDLRAEKTSLEKNLSERKKK--SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKA--RVSTDQAAAE-QLTL 784
Cdd:TIGR02168  318 LEELEAQLEELESKLDELAEELAELEEKleELKEELESLEAELEELEAELEELESRLEELEEQleTLRSKVAQLElQIAS 397
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  785 AQAELQSQwEAKCEQLlaSARDEHLQQYRE------VCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKS 858
Cdd:TIGR02168  398 LNNEIERL-EARLERL--EDRRERLQQEIEellkklEEAELKELQAELEELEEELEELQEELERLEEALEELREELEEAE 474

                   ..
gi 1242862604  859 QA 860
Cdd:TIGR02168  475 QA 476
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
570-854 2.90e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 71.28  E-value: 2.90e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  570 QENERLKQELLEKSSRIEEQNDKISDL-IERNQRYVEQSNLmmekrnnslqtatENTQAKVTEELAAATAQVSHLQLKMT 648
Cdd:COG1196    660 RSSLAQKRELKELEEELAELEAQLEKLeEELKSLKNELRSL-------------EDLLEELRRQLEELERQLEELKRELA 726
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  649 AHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEK-------QSRRQLELKVTSLEEELTDLR 721
Cdd:COG1196    727 ALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKeeieeleEKRQALQEELEELEEELEEAE 806
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  722 AEKTSLEKNLSerKKKSAQERCQAE-AEMDEIRKSHQEELDRLRQLLKKARVSTDQaAAEQLTLAQAELQSqweakceql 800
Cdd:COG1196    807 RRLDALERELE--SLEQRRERLEQEiEELEEEIEELEEKLDELEEELEELEKELEE-LKEELEELEAEKEE--------- 874
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1242862604  801 lasaRDEHLQQYREVCAQRDAHQQKLALLQDEC-LALQAQIAAFTEQKEHMQRLE 854
Cdd:COG1196    875 ----LEDELKELEEEKEELEEELRELESELAELkEEIEKLRERLEELEAKLERLE 925
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
651-895 1.96e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 68.54  E-value: 1.96e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  651 QKKETELQL--------QLTDNLKEtdlLRGHVTRLQA-------------------------DLSELREASEQTQTKFK 697
Cdd:TIGR02168  173 RRKETERKLertrenldRLEDILNE---LERQLKSLERqaekaerykelkaelrelelallvlRLEELREELEELQEELK 249
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  698 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK-----SAQERCQAEAEMDEIRKSH----QEELDRLRQLLK 768
Cdd:TIGR02168  250 EAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKElyalaNEISRLEQQKQILRERLANlerqLEELEAQLEELE 329
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  769 KARVsTDQAAAEQLTLAQAELQSQWEAKCEQL--LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQ 846
Cdd:TIGR02168  330 SKLD-ELAEELAELEEKLEELKEELESLEAELeeLEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEAR 408
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|
gi 1242862604  847 KEHMQ-RLEKTKSQAPAGRAAADPSEKvKKIMNQVFQSLRGEFELEESYD 895
Cdd:TIGR02168  409 LERLEdRRERLQQEIEELLKKLEEAEL-KELQAELEELEEELEELQEELE 457
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
566-788 1.66e-10

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 65.47  E-value: 1.66e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  566 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKrnnslqtaTENTQAKVTEELAAATAQVSHLQL 645
Cdd:TIGR02169  272 QLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELED--------AEERLAKLEAEIDKLLAEIEELER 343
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  646 KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK---FKSEKQS-----------RRQLELKVT 711
Cdd:TIGR02169  344 EIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKlekLKREINElkreldrlqeeLQRLSEELA 423
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  712 SLEEELTDLRAEKTSLE---KNLSERKKKSAQERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVSTDQAAAEQLTLA 785
Cdd:TIGR02169  424 DLNAAIAGIEAKINELEeekEDKALEIKKQEWKLEQLAADLSKYEQELydlKEEYDRVEKELSKLQRELAEAEAQARASE 503

                   ...
gi 1242862604  786 QAE 788
Cdd:TIGR02169  504 ERV 506
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
559-914 3.23e-10

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 64.40  E-value: 3.23e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  559 SMIMSNIQRIIQENERLKQELLEKSSRIEEQndkISDLIERNQRYVEQSNLMMEKRNNSLQTATENtqakvteELAAATA 638
Cdd:COG0419    170 EKLSELLKEVIKEAKAKIEELEGQLSELLED---IEDLLEALEEELKELKKLEEIQEEQEEEELEQ-------EIEALEE 239
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  639 QVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLElKVTSLEEELT 718
Cdd:COG0419    240 RLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELEEELE-GLRALLEELE 318
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  719 DLRAEKtsleKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCE 798
Cdd:COG0419    319 ELLEKL----KSLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELE--ERLEELEKELEKALERLKQLEEAIQ 392
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  799 QLLaSARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHmQRLEKTKSQAPAGRAAADPS-------E 871
Cdd:COG0419    393 ELK-EELAELSAALEEIQEELEELEKELEELERELEELEEEIKKLEEQINQ-LESKELMIAELAGAGEKCPVcgqelpeE 470
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|...
gi 1242862604  872 KVKKIMNQVFQSLRgefELEESYDGGTILRTIMHTIKMVTLQL 914
Cdd:COG0419    471 HEKELLELYELELE---ELEEELSREKEEAELREEIEELEKEL 510
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
571-903 5.66e-10

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 63.63  E-value: 5.66e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  571 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLmmEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTah 650
Cdd:COG0419    468 PEEHEKELLELYELELEELEEELSREKEEAELREEIEEL--EKELRELEEELIELLELEEALKEELEEKLEKLENLLE-- 543
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  651 QKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQ------TQTKFKSEKQSRRQLELKVTSLEEELTDLRAEK 724
Cdd:COG0419    544 ELEELKEKLQLQQLKEELRQLEDRLQELKELLEELRLLRTRkeeleeLRERLKELKKKLKELEERLSQLEELLQSLELSE 623
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  725 TSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARvstdqaaaeqltlAQAELQSQWEAKCEQLLasa 804
Cdd:COG0419    624 AENELEEAEEELESELEKLNLQAELEELLQAALEELEEKVEELEAEI-------------RRELQRIENEEQLEEKL--- 687
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  805 rdEHLQQYREVCAQRdahQQKLALLQDECLALQAQIAAFTEQKEHMQRLEK-TKSQAPAGRAAADPSEKVKKIMNQ--VF 881
Cdd:COG0419    688 --EELEQLEEELEQL---REELEELLKKLGEIEQLIEELESRKAELEELKKeLEKLEKALELLEELREKLGKAGLRadIL 762
                          330       340
                   ....*....|....*....|....*...
gi 1242862604  882 QSLRGEFELEES------YDGGTILRTI 903
Cdd:COG0419    763 RNLLAQIEAEANeilsklSLNRYDLRRL 790
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
561-776 6.50e-10

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 63.50  E-value: 6.50e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  561 IMSNIQRIIQENERLKQELLEkssrIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTaTENTQAKVTEELAAATAQV 640
Cdd:TIGR04523  202 LLSNLKKKIQKNKSLESQISE----LKKQNNQLKDNIEKKQQEINEKTTEISNTQTQLNQ-LKDEQNKIKKQLSEKQKEL 276
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  641 --SHLQLKMTAHQKKETELQLQLTDNLKETDLLRghvtRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELT 718
Cdd:TIGR04523  277 eqNNKKIKELEKQLNQLKSEISDLNNQKEQDWNK----ELKSELKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELT 352
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 1242862604  719 DLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDrLRQLLKKARVSTDQ 776
Cdd:TIGR04523  353 NSESENSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQIND-LESKIQNQEKLNQQ 409
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
507-768 8.85e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 63.15  E-value: 8.85e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  507 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSvtMETSMIMSNIQRIIQENERLKQELLEKSSRI 586
Cdd:TIGR02168  686 IEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALR--KDLARLEAEVEQLEERIAQLSKELTELEAEI 763
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  587 EEQNDKISDL------IERNQRYVEQSNLMMEKRNNSLQTATENTQAKVT------------------------------ 630
Cdd:TIGR02168  764 EELEERLEEAeeelaeAEAEIEELEAQIEQLKEELKALREALDELRAELTllneeaanlrerleslerriaaterrledl 843
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  631 -EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELK 709
Cdd:TIGR02168  844 eEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREK 923
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1242862604  710 VTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 768
Cdd:TIGR02168  924 LAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIK 982
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
598-1017 9.82e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 62.62  E-value: 9.82e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  598 ERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTR 677
Cdd:NF033930    75 DEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVP 154
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  678 LQADLSELREASEQTQTKfksEKQSRRQLELKVTSLEEELTDLRAEKTSLEKnlsERKKKSAQERCQAEAEmdeirkshq 757
Cdd:NF033930   155 EAEELAETKKKAEEAKAE---EPVAKKKVDEAKKKVEEAKKKVEAEEAEIEK---LQNEEVALEAKIAELE--------- 219
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  758 EELDRLRQLLKKARVSTDQAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLAL 828
Cdd:NF033930   220 NQVDNLEKELAEIDESDSEDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEE 292
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  829 LQDECLALQAQIAAFTEQKEHMQRLEktKSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIK 908
Cdd:NF033930   293 LSKKIDELDNEVAKLEKEVSDLENSD--NNVADYYKEALEKDLATKKA------------ELEK-------------TQK 345
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  909 MVTlQLLNHQEEEEEEEEEEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTP 984
Cdd:NF033930   346 DLD-KALNELGPDGDEEETPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKA 423
                          410       420       430
                   ....*....|....*....|....*....|...
gi 1242862604  985 EngaqtrkgEPAEAEVPSeikdsslPPQPAGIP 1017
Cdd:NF033930   424 E--------KPAPAPAPK-------PEQPAPAP 441
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
570-859 1.33e-09

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 61.63  E-value: 1.33e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  570 QENERLKQELL---------EKSSRIE-------------EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA 627
Cdd:pfam15742   13 EEVQQLRQDLHrlqilcssaERELRYEreknldlkqhnslLQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQ 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  628 KVTE-ELAAATAQVSHLQL------------KMTAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQT 692
Cdd:pfam15742   91 KIRElELEVLKQAQSIKSQnslqeklaqeksKVAEAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKL 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  693 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarv 772
Cdd:pfam15742  171 KQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS---- 244
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  773 stdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQ 851
Cdd:pfam15742  245 -------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQ 315

                   ....*...
gi 1242862604  852 RLEKTKSQ 859
Cdd:pfam15742  316 SQIEKEKA 323
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
515-789 1.68e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 62.38  E-value: 1.68e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  515 TEIRMAVNKVADKMDHLMTKVEELQKhssgnsmllpsmsvtmETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKIS 594
Cdd:TIGR02168  270 EELRLEVSELEEEIEELQKELYALAN----------------EISRLEQQKQILRERLANLERQLEELEAQLEELESKLD 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  595 DLIERNQRyveqsnlmMEKRNNSLQTATENTQAKVTE---ELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLL 671
Cdd:TIGR02168  334 ELAEELAE--------LEEKLEELKEELESLEAELEEleaELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERL 405
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  672 RGHVTRLQADLSELREasEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEknlsERKKKSAQERCQAEAEMDE 751
Cdd:TIGR02168  406 EARLERLEDRRERLQQ--EIEELLKKLEEAELKELQAELEELEEELEELQEELERLE----EALEELREELEEAEQALDA 479
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1242862604  752 IRKSHQEELDRLRQLLK-KARVSTDQAAAEQLTLAQAEL 789
Cdd:TIGR02168  480 AERELAQLQARLDSLERlQENLEGFSEGVKALLKNQSGL 518
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
516-859 2.36e-09

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 61.70  E-value: 2.36e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  516 EIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLpsmsvtmeTSMIMSNIQRIIQENE----RLKQELLEKSSRIEEQND 591
Cdd:COG0419    168 KYEKLSELLKEVIKEAKAKIEELEGQLSELLEDI--------EDLLEALEEELKELKKleeiQEEQEEEELEQEIEALEE 239
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  592 KISDLIERNQRYVEQSNLMMEKRNNSLQTAteNTQAKVTEELAAATAQVSHLQLKMTAHQK---KETELQLQLTDNLKET 668
Cdd:COG0419    240 RLAELEEEKERLEELKARLLEIESLELEAL--KIREEELRELERLLEELEEKIERLEELEReieELEEELEGLRALLEEL 317
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  669 DLLRGHVTRLQADLSELREASE----------QTQTKFKSEKQSR-RQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK 737
Cdd:COG0419    318 EELLEKLKSLEERLEKLEEKLEkleseleelaEEKNELAKLLEERlKELEERLEELEKELEKALERLKQLEEAIQELKEE 397
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  738 SAQ-----------------ERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVST-----------------DQAAAE 780
Cdd:COG0419    398 LAElsaaleeiqeeleelekELEELERELEELEEEIkklEEQINQLESKELMIAELAgagekcpvcgqelpeehEKELLE 477
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  781 QLTLAQAELQSQW-EAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDEclaLQAQIAAFTEQKEHMQRL-EKTKS 858
Cdd:COG0419    478 LYELELEELEEELsREKEEAELREEIEELEKELRELEEELIELLELEEALKEE---LEEKLEKLENLLEELEELkEKLQL 554

                   .
gi 1242862604  859 Q 859
Cdd:COG0419    555 Q 555
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
512-758 6.38e-09

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 60.03  E-value: 6.38e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  512 QHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGnsmllpsmsVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQND 591
Cdd:TIGR04523  211 QKNKSLESQISELKKQNNQLKDNIEKKQQEINE---------KTTEISNTQTQLNQLKDEQNKIKKQLSEKQKELEQNNK 281
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  592 KISDLIER-NQRYVEQSNLMMEKRnnslqtatENTQAKVTEELaaataqvshlqlkmTAHQKKETELQLQLTDNLKETDL 670
Cdd:TIGR04523  282 KIKELEKQlNQLKSEISDLNNQKE--------QDWNKELKSEL--------------KNQEKKLEEIQNQISQNNKIISQ 339
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  671 LRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQ---AEA 747
Cdd:TIGR04523  340 LNEQISQLKKELTNSESENSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDEQikkLQQ 419
                          250
                   ....*....|.
gi 1242862604  748 EMDEIRKSHQE 758
Cdd:TIGR04523  420 EKELLEKEIER 430
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
563-941 9.66e-09

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 59.77  E-value: 9.66e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  563 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER-NQRYVEQSNLMMEKRNN--SLQTATENTQAKVT--------- 630
Cdd:COG0419    315 EELEELLEKLKSLEERLEKLEEKLEKLESELEELAEEkNELAKLLEERLKELEERleELEKELEKALERLKqleeaiqel 394
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  631 -EELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETDLLRGHVTRLQADLSELREASEQ-----TQTKFKSEKQ 701
Cdd:COG0419    395 kEELAELSAALEEIQEELEELEKELEELErelEELEEEIKKLEEQINQLESKELMIAELAGAGEKcpvcgQELPEEHEKE 474
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  702 SRRQLELKVTSLEEELTdLRAEKTSLEKNLSERKKK---SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA 778
Cdd:COG0419    475 LLELYELELEELEEELS-REKEEAELREEIEELEKElreLEEELIELLELEEALKEELEEKLEKLENLLEELEELKEKLQ 553
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  779 AEQLtlaQAELQSqweakCEQLLASARDEhLQQYREVCAQrdahQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKS 858
Cdd:COG0419    554 LQQL---KEELRQ-----LEDRLQELKEL-LEELRLLRTR----KEELEELRERLKELKKKLKELEERLSQLEELLQSLE 620
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  859 QAPAGRAAADPSEKVKKIMNQVfqSLRGEFELEESYDGGTILRTIMHTIKMVtlQLLNHQEEEEEEEEEEEEEKKPLRPS 938
Cdd:COG0419    621 LSEAENELEEAEEELESELEKL--NLQAELEELLQAALEELEEKVEELEAEI--RRELQRIENEEQLEEKLEELEQLEEE 696

                   ...
gi 1242862604  939 LEQ 941
Cdd:COG0419    697 LEQ 699
PRK11281 PRK11281
mechanosensitive channel MscK;
616-869 1.22e-08

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 59.54  E-value: 1.22e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  616 NSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQT 694
Cdd:PRK11281    43 AQLDALNKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEET 114
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  695 KFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQaeAEMDEirksHQEELDRLRQLLKKARVST 774
Cdd:PRK11281   115 RETLSTLSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQ--AALYA----NSQRLQQIRNLLKGGKVGG 186
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  775 DQAAAEQLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEH 849
Cdd:PRK11281   187 KALRPSQRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKT 261
                          250       260
                   ....*....|....*....|
gi 1242862604  850 MQRLEktkSQAPAGRAAADP 869
Cdd:PRK11281   262 VQEAQ---SQDEAARIQANP 278
DUF5401 pfam17380
Family of unknown function (DUF5401); This is a family of unknown function found in ...
566-819 2.55e-08

Family of unknown function (DUF5401); This is a family of unknown function found in Chromadorea.


Pssm-ID: 375164 [Multi-domain]  Cd Length: 722  Bit Score: 58.21  E-value: 2.55e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  566 QRIIQENERLKQELlEKSSRIEEQNDKISDLIERNQR-YVEQSNLMMEkRNNSL------QTATENTQAKvTEELAAATA 638
Cdd:pfam17380  299 ERLRQEKEEKAREV-ERRRKLEEAEKARQAEMDRQAAiYAEQERMAME-RERELerirqeERKRELERIR-QEEIAMEIS 375
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  639 QVSHLQ-LKMTAHQKK----------------ETELQLQLTDNLKETDLLRGHVTRL-QADLSELREASEQTQTKFKSEK 700
Cdd:pfam17380  376 RMRELErLQMERQQKNervrqeleaarkvkilEEERQRKIQQQKVEMEQIRAEQEEArQREVRRLEEERAREMERVRLEE 455
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  701 QSRRQlelKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQAAAE 780
Cdd:pfam17380  456 QERQQ---QVERLRQQEEERKRKKLELEKEKRDRKRAEEQRRKILEKELEERKQAMIEE-ERKRKLLEKEMEERQKAIYE 531
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1242862604  781 QLTLAQAELQSQWEAKCEQllasaRDEHLQQYREVCAQR 819
Cdd:pfam17380  532 EERRREAEEERRKQQEMEE-----RRRIQEQMRKATEER 565
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
518-859 3.09e-08

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 58.06  E-value: 3.09e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  518 RMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM--IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISD 595
Cdd:TIGR00618  179 TQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERKqvLEKELKHLREALQQTQQSHAYLTQKREAQEEQLKK 258
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  596 LIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVtEELAAATAQVSHLQLKMtahQKKETELQLQLTDNLKEtdllRGHV 675
Cdd:TIGR00618  259 QQLLKQLRARIEELRAQEAVLEETQERINRARKA-APLAAHIKAVTQIEQQA---QRIHTELQSKMRSRAKL----LMKR 330
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  676 TRLQADLSELREASEQTQTKFKSEKQSRRQlelkvtslEEELTDLRAEKtSLEKNLSERKKKSAQERCQAEaemdEIRKS 755
Cdd:TIGR00618  331 AAHVKQQSSIEEQRRLLQTLHSQEIHIRDA--------HEVATSIREIS-CQQHTLTQHIHTLQQQKTTLT----QKLQS 397
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  756 HQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcaQRDAHQQKLALLQDECLA 835
Cdd:TIGR00618  398 LCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQELQQRYAELCAAAITCTAQCEK----LEKIHLQESAQSLKEREQ 473
                          330       340
                   ....*....|....*....|....*....
gi 1242862604  836 LQAQIAAFTEQ-----KEHMQRLEKTKSQ 859
Cdd:TIGR00618  474 QLQTKEQIHLQetrkkAVVLARLLELQEE 502
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
563-798 3.49e-08

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 57.77  E-value: 3.49e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  563 SNIQRIIQENErlkQELLEKSSRIEEQNDKISDLIERnQRYVEQSNLMMEKRNNSLqTATENTQAKVTEELAAATAQVSH 642
Cdd:PRK03918   189 ENIEELIKEKE---KELEEVLREINEISSELPELREE-LEKLEKEVKELEELKEEI-EELEKELESLEGSKRKLEEKIRE 263
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  643 LQlKMTAHQKKETElqlQLTDNLKETDLLRGHVTRLQAdLSELREaseqtqtKFKSEKqsrRQLELKVTSLEEELTDLRA 722
Cdd:PRK03918   264 LE-ERIEELKKEIE---ELEEKVKELKELKEKAEEYIK-LSEFYE-------EYLDEL---REIEKRLSRLEEEINGIEE 328
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1242862604  723 EKTSLEKnLSERKKKSAQERCQAEAEMDEIRKSHqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCE 798
Cdd:PRK03918   329 RIKELEE-KEERLEELKKKLKELEKRLEELEERH-ELYEEAKAKKEELERLKKRLTGLTPEKLEKELEELEKAKEE 402
PTZ00121 PTZ00121
MAEBL; Provisional
573-788 8.58e-08

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 57.07  E-value: 8.58e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  573 ERLKQELLEKSSRIEEQNDKisdliernqRYVEQSNLMMEKRNNSLQTATENTQAKvtEELAAATAQVSHLQLKMTAHQK 652
Cdd:PTZ00121  1544 EKKKADELKKAEELKKAEEK---------KKAEEAKKAEEDKNMALRKAEEAKKAE--EARIEEVMKLYEEEKKMKAEEA 1612
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  653 KETELQLQLTDNLKETDLLRGHVTRLQADLSE-------LREASEQT-----QTKFKSEKQSRRQLELKVTSLEEELTDL 720
Cdd:PTZ00121  1613 KKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEekkkaeeLKKAEEENkikaaEEAKKAEEDKKKAEEAKKAEEDEKKAAE 1692
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1242862604  721 RAEKTSLEKNLSER-KKKSAQERCQAEaemdEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAE 788
Cdd:PTZ00121  1693 ALKKEAEEAKKAEElKKKEAEEKKKAE----ELKKAEEENKIKAEEAKKEAE--EDKKKAEEAKKDEEE 1755
PTZ00121 PTZ00121
MAEBL; Provisional
571-874 9.42e-08

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 56.69  E-value: 9.42e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  571 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQA---KVTEELAAATAQVSHLQLKM 647
Cdd:PTZ00121  1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAaekKKEEAKKKADAAKKKAEEKK 1391
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  648 TAHQ-KKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDLRAEKTS 726
Cdd:PTZ00121  1392 KADEaKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAEEAKKKA 1466
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  727 LEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEAKCEQLL 801
Cdd:PTZ00121  1467 EEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAKKAEEKK 1546
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1242862604  802 ASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKVK 874
Cdd:PTZ00121  1547 KADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKIK 1621
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
508-880 1.19e-07

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 401982 [Multi-domain]  Cd Length: 765  Bit Score: 55.99  E-value: 1.19e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  508 TEARQhnTEIRMAVNKVAdKMDHLMTKVEELQKHSSGNSML--------LPSMSVTMETSMIMSN-IQRIIQENERLKQE 578
Cdd:pfam10174  227 TKALQ--TVIEMKDTKIS-SLERNIRDLEDEVQMLKTNGLLhtedreeeIKQMEVYKSHSKFMKNkIDQLKQELSKKESE 303
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  579 LLEKSSRIEEQNDKISD-----------LIERNQRY------VEQSNLMMEKRNNSLQTATENTQaKVTEELAAATAQVS 641
Cdd:pfam10174  304 LLALQTKLETLTNQNSDckqhievlkesLTAKEQRAailqteVDALRLRLEEKESFLNKKTKQLQ-DLTEEKSTLAGEIR 382
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  642 HLQ-------LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADlselreaSEQTQTkfksekqsrrqlelKVTSLE 714
Cdd:pfam10174  383 DLKdmldvkeRKINVLQKKIENLQEQLRDKDKQLAGLKERVKSLQTD-------SSNTDT--------------ALTTLE 441
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  715 EELtdlrAEKTSLEKNLSERKKKSAQERcqaeaemdeirkshQEELDRLRQLLKKARvstdqaaaEQLTLAQAELQSQwe 794
Cdd:pfam10174  442 EAL----SEKERIIERLKEQREREDRER--------------LEELESLKKENKDLK--------EKVSALQPELTEK-- 493
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  795 akcEQLLASARdEHLQQYREVCAQRDAH--QQKLALLQ--DECLALQAQiaafteqkehmqrLEKTKSQAPAGRAAADPS 870
Cdd:pfam10174  494 ---ESSLIDLK-EHASSLASSGLKKDSKlkSLEIAIEQkkEECSKLENQ-------------LKKAHNAEEAVRTNPEIN 556
                          410
                   ....*....|
gi 1242862604  871 EKVKKIMNQV 880
Cdd:pfam10174  557 DRIRLLEQEV 566
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
666-893 1.44e-07

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 55.42  E-value: 1.44e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  666 KETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaQERCQA 745
Cdd:COG4372    123 QELAAARQNLAKAQQELARLTKQAQDLQTRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLR--SAQIEQ 200
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  746 EAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqweakceqllASARDEHLQQyREVCAQRdaHQQK 825
Cdd:COG4372    201 EAQNLATRANAAQARTEELARRAAAAQQTAQAIQQRDAQISQKAQQ----------IAARAEQIRE-RERQLQR--LETA 267
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  826 LALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADpSEKVKKIMNQVFQSLR--GEFELEES 893
Cdd:COG4372    268 QARLEQEVAQLEAYYQAYVRLRQQAAATQRGQVLAGAAQRVAQ-AQAQAQAQAQLLSSANrpAALRLRRS 336
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
569-830 1.44e-07

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 55.42  E-value: 1.44e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  569 IQENERLKQELLEKSSRIEEQNDkisdlIERNQRYVEQSNLMMEKRNNSLQTATENTQ-AKVTEELAAATAQVSHLQ--L 645
Cdd:COG4372     79 IRPQLRALRTELGTAQGEKRAAE-----TEREAARSELQKARQEREAVRQELAAARQNlAKAQQELARLTKQAQDLQtrL 153
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  646 KMTAHQKKETELQLQLTDNlkETDLLRGHVTRLQADLSELREASEQTQTKFKsEKQSRRQlelKVTSLEEELTDLRAEKT 725
Cdd:COG4372    154 KTLAEQRRQLEAQAQSLQA--SQKQLQASATQLKSQVLDLKLRSAQIEQEAQ-NLATRAN---AAQARTEELARRAAAAQ 227
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  726 SLEKNLSERKKKsAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKCE-QLLASA 804
Cdd:COG4372    228 QTAQAIQQRDAQ-ISQKAQQIAARAEQIRERERQLQRLET--AQARLEQEVAQLEAYYQAYVRLRQQAAATQRgQVLAGA 304
                          250       260
                   ....*....|....*....|....*...
gi 1242862604  805 --RDEHLQQYREVCAQRDAHQQKLALLQ 830
Cdd:COG4372    305 aqRVAQAQAQAQAQAQLLSSANRPAALR 332
MscS_porin pfam12795
Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part ...
649-860 1.54e-07

Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this MscS_porin is towards the N-terminal of the molecules. The high concentration of negative charges at the extracellular entrance of the pore helps select the cations for efflux.


Pssm-ID: 403869 [Multi-domain]  Cd Length: 235  Bit Score: 53.83  E-value: 1.54e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  649 AHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSElreaseqtQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLE 728
Cdd:pfam12795   34 KSKQRAAQYQKALDDAPAELRELRQELAALQAKAEA--------APKEILASLSLEELEQRLLQTSSQLQELQEQLAQLN 105
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  729 KNLSERKKKSAQercqAEAEMDEIRkshqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQW----EAKCEQLLASA 804
Cdd:pfam12795  106 SQLIELQTRPER----AQQQLSEAR----QRLQQIRNQLNGLAAAGEPLSEAQRWLLQAELAALKaqidMLEQELLSNNN 177
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1242862604  805 RDEHLQqyrevcAQRDAHQQKLALLQDECLALQAQIAAfteqkehmQRLEKTKSQA 860
Cdd:pfam12795  178 RQDLLQ------AQRDLLTLRIARLEQQLQALQELLNE--------KRLAEAEQAV 219
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
679-895 1.66e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 55.83  E-value: 1.66e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  679 QADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKK--KSAQERCQAEAEMDEIRKSH 756
Cdd:TIGR02168  676 RREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKdlARLEAEVEQLEERIAQLSKE 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  757 QEELDRLRQLLKKARVSTDQAAAE------QLTLAQAELQSQWEAKCEQlLASARDEHLQQYREVCAQR---DAHQQKLA 827
Cdd:TIGR02168  756 LTELEAEIEELEERLEEAEEELAEaeaeieELEAQIEQLKEELKALREA-LDELRAELTLLNEEAANLRerlESLERRIA 834
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1242862604  828 LLQDECLALQAQIAaftEQKEHMQRLEktKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYD 895
Cdd:TIGR02168  835 ATERRLEDLEEQIE---ELSEDIESLA--AEIEELEELIEELESELEALLNERASLEEALALLRSELE 897
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
570-860 2.02e-07

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 55.43  E-value: 2.02e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  570 QENERLKQELLEKSSRIEEQNDKISDLIERNQryveqsnlmmEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTA 649
Cdd:PRK02224   251 EELETLEAEIEDLRETIAETEREREELAEEVR----------DLRERLEELEEERDDLLAEAGLDDADAEAVEARREELE 320
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  650 HQKKET-----ELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRaek 724
Cdd:PRK02224   321 DRDEELrdrleECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELR--- 397
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  725 tsleknlsERKKKSAQERCQAEAEMDEIRkshqEELDRLRQLLKKARVSTdQAAAEQLTLAQAELQSQWEAKCEQLLA-S 803
Cdd:PRK02224   398 --------ERFGDAPVDLGNAEDFLEELR----EERDELREREAELEATL-RTARERVEEAEALLEAGKCPECGQPVEgS 464
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  804 ARDEHLQQYREvcaQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQA 860
Cdd:PRK02224   465 PHVETIEEDRE---RVEELEAELEDLEEEVEEVEERLERAEDLVEAEDRIERLEERR 518
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
527-860 2.61e-07

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 55.12  E-value: 2.61e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  527 KMDHLMTKVEELQKHSSgnsmllpsMSVTMETSMIMsnIQRIIQEnerlkqeLLEKSSRIEEQNDKISDL---IERNQRY 603
Cdd:pfam15921  449 QMAAIQGKNESLEKVSS--------LTAQLESTKEM--LRKVVEE-------LTAKKMTLESSERTVSDLtasLQEKERA 511
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  604 VEQSNLMMEKRNNSLQTATENTQAKVTEE--LAAATAQVSHLQLKMtAHQKKETELQLQLTDNLkeTDLLRGH---VTRL 678
Cdd:pfam15921  512 IEATNAEITKLRSRVDLKLQELQHLKNEGdhLRNVQTECEALKLQM-AEKDKVIEILRQQIENM--TQLVGQHgrtAGAM 588
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  679 QADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSER---KKKSAQERCQAeaeMDEIRKS 755
Cdd:pfam15921  589 QVEKAQLEKEINDRRLELQEFKILKDKKDAKIRELEARVSDLELEKVKLVNAGSERlraVKDIKQERDQL---LNEVKTS 665
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  756 HQE--ELDRLRQLLKKarvsTDQAAAEQLTLAQAELQSQweakceqlLASARDEhLQQYREVCAQ---RDAHQQKLAL-L 829
Cdd:pfam15921  666 RNElnSLSEDYEVLKR----NFRNKSEEMETTTNKLKMQ--------LKSAQSE-LEQTRNTLKSmegSDGHAMKVAMgM 732
                          330       340       350
                   ....*....|....*....|....*....|.
gi 1242862604  830 QDECLALQAQIAAFTEQkehMQRLEKTKSQA 860
Cdd:pfam15921  733 QKQITAKRGQIDALQSK---IQFLEEAMTNA 760
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
567-832 3.89e-07

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 54.41  E-value: 3.89e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  567 RIIQENERLKQELLEKSSRIEEQNDK--------------ISDLIERNQRYvEQSNLMMEKRNNSLQTATENTQakvtEE 632
Cdd:pfam01576  149 KLSKERKLLEERISEFTSNLAEEEEKvkslnklknkheamISDLEDRLKKE-EKGRQELEKAKRKLDGESTDLQ----EQ 223
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  633 LAAATAQVSHLQLKMtahQKKETELQLQLTDNLKET---DLLRGHVTRLQADLSELREASEQT-QTKFKSEKQsRRQLEL 708
Cdd:pfam01576  224 IAELQAQIEELRAQL---AKKEEELQAALARLEEEGaqkNNALKKLRELQAQIAELQEDLESErAARAKAEKQ-RRDLGE 299
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  709 KVTSLEEELTD----------LRAEKtslEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVS----- 773
Cdd:pfam01576  300 ELEALKTELEDtldstaaqqeLRSKR---EQEVTELKKALEEETRSHEAQLQEMRQKHTQALEELSEQLEQAKRNkanle 376
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  774 -TDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEhlQQYREVCA-------QRDAHQQKLALLQDE 832
Cdd:pfam01576  377 kAKQALESENNELQAELKTLQQAKQDSEHKRKKLE--GQLQELQArlseserQRAELAEKLSKLQSE 441
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
570-768 5.56e-07

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 54.03  E-value: 5.56e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  570 QENERLKQELLEKSSRIEEQNDKISDLIERnqryVEQSNLMMEKRNNSLQTATENTQAKVTEElaaaTAQVSHLQLKMTA 649
Cdd:pfam01576  422 SESERQRAELAEKLSKLQSELESVSGLLSE----AEGKSIKLSKDVSSLESQLQDTQELLQEE----TRQKLNLSSRLRQ 493
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  650 HQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR----------EASEQTQTKFKSEKQSRRQ-----------LEL 708
Cdd:pfam01576  494 LEDERNSLQEQLEEEEEAKRNVERQLSTLQAQLSEMKkkleedagavEALEEAKKRLQRELEALTQrleekaaaydkLEK 573
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  709 KVTSLEEELTDL-------RAEKTSLEKN-------LSERKKKSAQ---ERCQAEAEMDEIR-------------KSHQE 758
Cdd:pfam01576  574 TKNRLQQELDDLlvdldhqRQLVSNLEKKqkkfdqmLAEEKAISARyaeERDRAEAEAREKEtralslsraleeaLEAKE 653
                          250
                   ....*....|
gi 1242862604  759 ELDRLRQLLK 768
Cdd:pfam01576  654 ELERQNKQLR 663
PRK11281 PRK11281
mechanosensitive channel MscK;
564-790 8.02e-07

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 53.38  E-value: 8.02e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  564 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERN-----QRYVEQSNLMMEKRNNSLQTATENTQakvtEELAAATA 638
Cdd:PRK11281    74 KIDRQKEETEQLKQQLAQAPAKLRQAQAELEALKDDNdeetrETLSTLSLRQLESRLAQTLDQLQNAQ----NDLAEYNS 149
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  639 QVSHLQLK-------MTAHQKKETELQLQLTDNLKETDLLRG-HVTRLQADLS------ELREASEQTQTKFKSEKQSRR 704
Cdd:PRK11281   150 QLVSLQTQperaqaaLYANSQRLQQIRNLLKGGKVGGKALRPsQRVLLQAEQAllnaqnDLQRKSLEGNTQLQDLLQKQR 229
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  705 QL-ELKVTSLEEELTDLRAEKTslEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAaeqlT 783
Cdd:PRK11281   230 DYlTARIQRLEHQLQLLQEAIN--SKRLTLSEKTVQEAQSQDEAARIQANPLVAQELEINLQLSQRLLKATEKLN----T 303

                   ....*..
gi 1242862604  784 LAQAELQ 790
Cdd:PRK11281   304 LTQQNLR 310
DUF812 pfam05667
Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of ...
571-852 8.30e-07

Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of unknown function.


Pssm-ID: 398992 [Multi-domain]  Cd Length: 590  Bit Score: 53.09  E-value: 8.30e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  571 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAH 650
Cdd:pfam05667  223 EEEWNSQGLASRLTPEEYRKRKRTKLLKRIAEQLRSAALASTEATSGASRSAQDLAELLSSFGGSSTTDTNLTKGSRFTH 302
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  651 QKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN 730
Cdd:pfam05667  303 TEKLQFTNEAAASPPSKAETEEELQQQREEELEELQEQLEDLESSIEELEKEIKKLESSIKQVEEELEELKEQNEELEKQ 382
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  731 LsERKKKSAQERCQAEAEMDEirkshqeeldrlrqlLKKARvstdQAAAEQLtlaqAELQSQWEAKCEQLLasardEHLQ 810
Cdd:pfam05667  383 Y-KVKKKTLDLLPDAEENIAK---------------LQAVV----EASAQRL----VELAGQWEKHRVPLI-----EEYR 433
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*.
gi 1242862604  811 QYREVCAQR-DAHQQKLA---LLQDECLalqaQIAAFTEQKEHMQR 852
Cdd:pfam05667  434 ALKEAKSNKeSESQRKLEeikELREKIK----EVAEEARSKEELYK 475
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
623-769 1.12e-06

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 51.21  E-value: 1.12e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  623 ENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLK-------ETDLLRGHVTRLQADLSELREASEQTQTK 695
Cdd:COG1579      2 MNNNLKSLLAIQKLDLEKDRLEPRIKEIRKALKKAKAELEALNKalealeiELEDLENQVSQLESEIQEIRERIKRAEEK 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  696 FKSEKQSRR---------QLELKVTSLEEELTDLRAEKTSLEKNL-SERKKKSAQERC------QAEAEMDEIRKSHQEE 759
Cdd:COG1579     82 LSAVKDERElralnieiqIAKERINSLEDELAELMEEIEKLEKEIeDLKERLERLEKNlaeaeaRLEEEVAEIREEGQEL 161
                          170
                   ....*....|
gi 1242862604  760 LDRLRQLLKK 769
Cdd:COG1579    162 SSKREELKEK 171
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
563-888 1.32e-06

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 52.76  E-value: 1.32e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  563 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRY--------------VEQSNLMMEKRNNSLQTAtENTQAK 628
Cdd:PRK03918   324 NGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYeeakakkeelerlkKRLTGLTPEKLEKELEEL-EKAKEE 402
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  629 VTEELAAATAQVSHL------------QLK------------MTAHQKKE-------------------TELQLQLTDNL 665
Cdd:PRK03918   403 IEEEISKITARIGELkkeikelkkaieELKkakgkcpvcgreLTEEHRKElleeytaelkriekelkeiEEKERKLRKEL 482
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  666 KETDLLRGHVTRLQA------------------DLSELREASEQTQT-------------KFKSEKQSRRQLELKVTSLE 714
Cdd:PRK03918   483 RELEKVLKKESELIKlkelaeqlkeleeklkkyNLEELEKKAEEYEKlkekliklkgeikSLKKELEKLEELKKKLAELE 562
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  715 EELTDLRAEKTSLEKNLSERKKKSAQErcqAEAEMDEIRKSHQE---------ELDRLRQLLKKARVSTDQAAAEqLTLA 785
Cdd:PRK03918   563 KKLDELEEELAELLKELEELGFESVEE---LEERLKELEPFYNEylelkdaekELEREEKELKKLEEELDKAFEE-LAET 638
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  786 QAELQSQwEAKCEQLLASARDEhlqQYREVcaqrdahQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAGR 864
Cdd:PRK03918   639 EKRLEEL-RKELEELEKKYSEE---EYEEL-------REEYLELSRELAGLRAELEELEKRREEIKKtLEKLKEELEERE 707
                          410       420
                   ....*....|....*....|....
gi 1242862604  865 AAADPSEKVKKIMNQVfQSLRGEF 888
Cdd:PRK03918   708 KAKKELEKLEKALERV-EELREKV 730
SlpA COG1047
FKBP-type peptidyl-prolyl cis-trans isomerase 2 [Posttranslational modification, protein ...
192-253 1.35e-06

FKBP-type peptidyl-prolyl cis-trans isomerase 2 [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223976  Cd Length: 174  Bit Score: 49.56  E-value: 1.35e-06
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1242862604  192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKR 253
Cdd:COG1047      2 KIEKGDVVSLHYTLKVED----GEVVDTTDENYGPLTFIVGAGQLIPGLEEALLGKEVGEEF 59
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
495-853 1.39e-06

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 52.81  E-value: 1.39e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  495 HFQGSGDMMSFLMteaRQHNTEIRMAVNKVADKMDHLmtkvEELQKHSSGNSMLLPSMSvtmetsmiMSNIQRIIQENER 574
Cdd:pfam15921  214 HFRSLGSAISKIL---RELDTEISYLKGRIFPVEDQL----EALKSESQNKIELLLQQH--------QDRIEQLISEHEV 278
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  575 LKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKE 654
Cdd:pfam15921  279 EITGLTEKASSARSQANSIQSQLEIIQEQARNQNSMYMRQLSDLESTVSQLRSELREAKRMYEDKIEELEKQLVLANSEL 358
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  655 TELQLQLTDNLKETDLLRGHVTRLQADL----SELREASEQTQTKFKSEKQS-------RRQLE---LKVTSLEEELTDL 720
Cdd:pfam15921  359 TEARTERDQFSQESGNLDDQLQKLLADLhkreKELSLEKEQNKRLWDRDTGNsitidhlRRELDdrnMEVQRLEALLKAM 438
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  721 RAE-KTSLEKNLS--ERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKC 797
Cdd:pfam15921  439 KSEcQGQMERQMAaiQGKNESLEKVSSLTAQLESTKEMLRKVVEELTA--KKMTLESSERTVSDLTASLQEKERAIEATN 516
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1242862604  798 EQL--LASARDEHLQQYREVCAQRDAHQQklalLQDECLALQAQIAA-------FTEQKEHMQRL 853
Cdd:pfam15921  517 AEItkLRSRVDLKLQELQHLKNEGDHLRN----VQTECEALKLQMAEkdkvieiLRQQIENMTQL 577
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
651-941 1.98e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 52.38  E-value: 1.98e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  651 QKKETELQLQLTDNLKETDLLRGHVTRLQadlSELREASEQTqtkfkSEKQSRRQ-LELKVTSLEEELTDL--------- 720
Cdd:TIGR02169  680 RERLEGLKRELSSLQSELRRIENRLDELS---QELSDASRKI-----GEIEKEIEqLEQEEEKLKERLEELeedlssleq 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  721 -----RAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEqltlAQAELQSqwEA 795
Cdd:TIGR02169  752 eienvKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQAELSKLEEEVSRIEARLRE----IEQKLNR--LT 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  796 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAaftEQKEHMQRLEKTKSqapagraaaDPSEKVKK 875
Cdd:TIGR02169  826 LEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELE---ELEAALRDLESRLG---------DLKKERDE 893
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1242862604  876 IMNQVFQSLRGEFELEESYDggtILRTIMHTIKmVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQ 941
Cdd:TIGR02169  894 LEAQLRELERKIEELEAQIE---KKRKRLSELK-AKLEALEEELSEIEDPKGEDEEIPEEELSLED 955
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
627-859 2.22e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 51.99  E-value: 2.22e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  627 AKVTEELAAATAQVSHLQLKmtahqkkETELQLQLtDNLKETdllRGHVTRLQADLSELR--EASEQTQTKFKSEKQsRR 704
Cdd:TIGR02169  173 EKALEELEEVEENIERLDLI-------IDEKRQQL-ERLRRE---REKAERYQALLKEKReyEGYELLKEKEALERQ-KE 240
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  705 QLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRL----RQLLKKARVSTDQA--A 778
Cdd:TIGR02169  241 AIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELeaeiASLERSIAEKERELedA 320
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  779 AEQLTLAQAELQSQwEAKCEQLlasarDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQI--------AAFTEQKEHM 850
Cdd:TIGR02169  321 EERLAKLEAEIDKL-LAEIEEL-----EREIEEER---KRRDKLTEEYAELKEELEDLRAELeevdkefaETRDELKDYR 391

                   ....*....
gi 1242862604  851 QRLEKTKSQ 859
Cdd:TIGR02169  392 EKLEKLKRE 400
Macoilin pfam09726
Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 ...
624-847 2.53e-06

Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.


Pssm-ID: 401607  Cd Length: 664  Bit Score: 51.77  E-value: 2.53e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  624 NTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQTQTKFKS----- 698
Cdd:pfam09726  382 NNQLSKPDALVRLEQDIKKLKAELQASRQTEQELRSQI-------SSLTSLERSLKSELGQLRQENDLLQTKLHNavsak 454
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  699 --EKQSRRQLELKvtsLEEEltdlRAEKTSLEKNLSERKK-------KSAQERCQAEA---EMDEIRKSHQEELD-RLRQ 765
Cdd:pfam09726  455 qkDKQTVQQLEKR---LKAE----QEARASAEKQLAEEKKrkkeeeaTAARAVALAAAsrgECTESLKQRKRELEsEIKK 527
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  766 LLKKARVSTDQAAaeqltlaqaelqsQWEAKCEQllasardehLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTE 845
Cdd:pfam09726  528 LTHDIKLKEEQIR-------------ELEIKVQE---------LRKYKESEKDTEVLMSALSAMQDKNQHLENSLSAETR 585

                   ..
gi 1242862604  846 QK 847
Cdd:pfam09726  586 IK 587
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
566-852 2.90e-06

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 51.68  E-value: 2.90e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  566 QRIIQENERLKQELLEKSSRIEEQNDKIS----------------DLIERNQRYVEQSNLMME-----------KRNNSL 618
Cdd:pfam12128  425 HQLEQQKLEFNEEQYLLESRLGELKLQLNqatatpellenieqndERLERAQEAQEQANASVEaaqselrqlrkRRDEAD 504
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  619 QTATENTQAkvTEELAAATAQVsHLQLKMTAHQK-----------KETELQLQLTDNLKETDL----------------L 671
Cdd:pfam12128  505 EALRRANRR--LEQLKQALQQL-ELQLSPQAGSLlhflrneapdwEQSIGKLISTELLHRTDLdpelvesssqelnlygV 581
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  672 RGHVTRLQADLS-----ELREASEQTQTKFKSEKQsrrqlelKVTSLEEELTDLRAEKTSLEKNLSERKkksaQERCQAE 746
Cdd:pfam12128  582 TLDLQRIDAPDYaaleeALRERLDQAEKALQAARD-------KQKAAEEQLVQLNKELEKLKREETEAA----RALKQAR 650
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  747 AEMDEIRKSHQEELDRLRQLLKKARvstdQAAAEQLTLAQAEL------QSQWEAKCEQLLASARDEHLQQYREVCAQRD 820
Cdd:pfam12128  651 LTLGRLQDEKQSLKDKLQKALKARK----QQAETQLQTLDAQLkqllkkQQAALEEQKEQLRELRTEKQEKWQVVVGDLD 726
                          330       340       350
                   ....*....|....*....|....*....|...
gi 1242862604  821 AhqqKLALLQDECLALQAQIAAFTEQ-KEHMQR 852
Cdd:pfam12128  727 A---QLALLSAAIAALRTQAKAQLKAlEEQYKR 756
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
574-894 3.33e-06

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 51.51  E-value: 3.33e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  574 RLKQELLEKSsriEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMtahQKK 653
Cdd:TIGR00618  153 EFAQFLKAKS---KEKKELLMNLFPLDQ--YTQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERK---QVL 224
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  654 ETELQlQLTDNLKETDllrghvtRLQADLSELREASEQTQTKFKSEKQSRRQLElKVTSLEEELtdlraEKTSLEKNLSE 733
Cdd:TIGR00618  225 EKELK-HLREALQQTQ-------QSHAYLTQKREAQEEQLKKQQLLKQLRARIE-ELRAQEAVL-----EETQERINRAR 290
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  734 RKKKSAQErcqaEAEMDEIRKSHQEELDRLRQ---LLKKARVSTDQAAAEQLTL-AQAELQSQWEAKCEQLlasaRDEHL 809
Cdd:TIGR00618  291 KAAPLAAH----IKAVTQIEQQAQRIHTELQSkmrSRAKLLMKRAAHVKQQSSIeEQRRLLQTLHSQEIHI----RDAHE 362
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  810 QQyrevCAQRDAHQQKLALLQdECLALQAQIAAFTEQkehMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFE 889
Cdd:TIGR00618  363 VA----TSIREISCQQHTLTQ-HIHTLQQQKTTLTQK---LQSLCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQE 434

                   ....*
gi 1242862604  890 LEESY 894
Cdd:TIGR00618  435 LQQRY 439
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
563-753 3.76e-06

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 51.17  E-value: 3.76e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  563 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERN----------QRYVEQSNLMMEKRNNSLQTATENTQAKVTE- 631
Cdd:TIGR04523  412 EQIKKLQQEKELLEKEIERLKETIIKNNSEIKDLTNQDsvkeliiknlDNTRESLETQLKVLSRSINKIKQNLEQKQKEl 491
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  632 -----ELAAATAQVSHL------------QLKMTAHQ------KKETELQlQLTDNLKETD------LLRGHVTRLQADL 682
Cdd:TIGR04523  492 kskekELKKLNEEKKELeekvkdltkkisSLKEKIEKlesekkEKESKIS-DLEDELNKDDfelkkeNLEKEIDEKNKEI 570
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  683 SELRE---ASEQTQTKFK-------SEKQS-RRQLELK---VTSLEEELTDLRAEKTSLE---KNLSERKKKSAQERCQA 745
Cdd:TIGR04523  571 EELKQtqkSLKKKQEEKQelidqkeKEKKDlIKEIEEKekkISSLEKELEKAKKENEKLSsiiKNIKSKKNKLKQEVKQI 650

                   ....*...
gi 1242862604  746 EAEMDEIR 753
Cdd:TIGR04523  651 KETIKEIR 658
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
547-742 5.78e-06

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 50.39  E-value: 5.78e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  547 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLqtATENTQ 626
Cdd:NF038025    23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDEL--ATEANK 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  627 AKVteELAAATAQVSHLQLKMTAHQKKETELqlqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkfksEKQSRRQ- 705
Cdd:NF038025    92 ASA--ELDEVNAEIQGVKEEIKEKQEQLMVL------DTKE-------------ELDELSE-----------EELAERQe 139
                          170       180       190
                   ....*....|....*....|....*....|....*..
gi 1242862604  706 LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 742
Cdd:NF038025   140 LEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
COG1340 COG1340
Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];
516-737 6.90e-06

Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];


Pssm-ID: 224259 [Multi-domain]  Cd Length: 294  Bit Score: 49.29  E-value: 6.90e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  516 EIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSmsvtmetsmIMSnIQRIIQENERLKQEL---LEKSSRIEEQNDK 592
Cdd:COG1340     73 ELKEKRDEINAKLQELRKEYRELKEKRNEFNLGGRS---------IKS-LEREIERLEKKQQTSvltPEEERELVQKIKE 142
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  593 ISDLIERNQRyveqsnlmMEKRNNSLQtateNTQAKVTEELAAAtaqvSHLQLKMTAHQKKETELQLQLTDNLKETDLLR 672
Cdd:COG1340    143 LRKELEDAKK--------ALEENEKLK----ELKAEIDELKKKA----REIHEKIQELANEAQEYHEEMIKLFEEADELR 206
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  673 GHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDL--RAEKTSLEKNLSERKKK 737
Cdd:COG1340    207 KEADELHEEFVELSKKIDELHEEFRNLQNELRELEKKIKALRAKEKAAkrREKREELKERAEEIYEK 273
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
557-793 6.93e-06

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 49.72  E-value: 6.93e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  557 ETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryveqsnlmMEKRNNSLQTATENTQAKVTEELAAA 636
Cdd:COG4942     60 QRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIAD---------------LNARLNALEVQEREQRRRLAEQLAAL 124
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  637 TAQVSH--LQLKMTAHQKKETEL-----------QLQLTDNLKETdllRGHVTRLQADLSELREASEQTQTKFKSE---- 699
Cdd:COG4942    125 QRSGRNppPALLVSPEDAQRSVRlaiyygalnpaRAERIDALKAT---LKQLAAVRAEIAAEQAELTTLLSEQRAQqakl 201
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  700 -------KQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQlLKKARV 772
Cdd:COG4942    202 aqlleerKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEAAAAKAREAAAAAEAAAARARAAEAKRTGE-TYKPTA 280
                          250       260
                   ....*....|....*....|.
gi 1242862604  773 STDQAAAEQLTLAQAELQSQW 793
Cdd:COG4942    281 PEKMLISSTGGFGALRGQLAW 301
mukB PRK04863
chromosome partition protein MukB;
573-871 1.23e-05

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 49.57  E-value: 1.23e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  573 ERLKQELLEkssrIEEQNDKISDLIERNQRYVEQSNLMMekrNNSLQTATENTQAkvtEELAAATAQVSHLQLKMTAHQK 652
Cdd:PRK04863   789 EQLRAEREE----LAERYATLSFDVQKLQRLHQAFSRFI---GSHLAVAFEADPE---AELRQLNRRRVELERALADHES 858
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  653 KETELQLQLtDNLKET-DLLRGHVTR--------LQADLSELREASEQTQTKFKSEKQSRRQLELkvtsLEEELTDLRAE 723
Cdd:PRK04863   859 QEQQQRSQL-EQAKEGlSALNRLLPRlnlladetLADRVEEIREQLDEAEEAKRFVQQHGNALAQ----LEPIVSVLQSD 933
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  724 ktsleknlserkkksaqercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA---------AEQLTLAQAELQSQWE 794
Cdd:PRK04863   934 ----------------------PEQFEQLKQDYQQAQQTQRDAKQQAFALTEVVQrrahfsyedAAEMLAKNSDLNEKLR 991
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  795 AKCEQlLASARDEHLQQYREVCAQrdaHQQKLALLQDeclaLQAQIAAFTEQ-KEHMQRLEKTKSQAPAG---RAAADPS 870
Cdd:PRK04863   992 QRLEQ-AEQERTRAREQLRQAQAQ---LAQYNQVLAS----LKSSYDAKRQMlQELKQELQDLGVPADSGaeeRARARRD 1063

                   .
gi 1242862604  871 E 871
Cdd:PRK04863  1064 E 1064
TPH pfam13868
Trichohyalin-plectin-homology domain; This family is a mixtrue of two different families of ...
569-854 1.41e-05

Trichohyalin-plectin-homology domain; This family is a mixtrue of two different families of eukaryotic proteins. Trichoplein or mitostatin, was first defined as a meiosis-specific nuclear structural protein. It has since been linked with mitochondrial movement. It is associated with the mitochondrial outer membrane, and over-expression leads to reduction in mitochondrial motility whereas lack of it enhances mitochondrial movement. The activity appears to be mediated through binding the mitochondria to the actin intermediate filaments (IFs). The family is in the trichohyalin-plectin-homology domain.


Pssm-ID: 404709 [Multi-domain]  Cd Length: 352  Bit Score: 48.76  E-value: 1.41e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  569 IQENERLKQELLEKSSRIEEQndkisdliernqryveqsnlMMEKRNNSLQTATENTQAKVTEELAAAtaQVSHLQLKMT 648
Cdd:pfam13868   28 IAEKKRIKAEEKEEERRLDEM--------------------MEEEREKALEEEEEKEEERKEKRKEYR--QELEQQIEER 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  649 AHQKKETELQLqltdnLKETDLLRGHVTRLQADlselreasEQTQTKFKSEKQSRRQLELKVTSleEELTDLRAEKTSLE 728
Cdd:pfam13868   86 EKKRQEEYEEK-----LQEKEMIDEIVEKIQEE--------DEAEAEEKLEKQKELREEIDEFN--EEQAEWKELEKEEE 150
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  729 KNLSERKKKSAQERCQAEAEMD----EIRKSHQEELDRLRQLLKKARvsTDQAAAEQL--TLAQAELQSQWEAK------ 796
Cdd:pfam13868  151 KEEDERILEYLKEKEEREEEREaerrEIEEEKEREIARLRAQQEKAQ--DEKEERDELraDLYQEEQERKWRQKereeae 228
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1242862604  797 ----CEQLLASARDEHL---QQYREVCAQRDAHQQKLALLQdecLALQAQIAAFTEQKEHMQRLE 854
Cdd:pfam13868  229 kkarQRQELRQAREEQVelkERRLAEEAEREEEEFERMLRK---QAEDERIEQEEAEKRRMKRLE 290
PTZ00121 PTZ00121
MAEBL; Provisional
571-875 2.12e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 48.98  E-value: 2.12e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  571 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATEntqAKVTEELAAATAQVSHLQLKMTAH 650
Cdd:PTZ00121  1480 EEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEAKKAEE---AKKADEAKKAEEKKKADELKKAEE 1556
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  651 QKKETELQLQLTDNLKETDllRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKvtslEEELTDLRAEKtsLEKN 730
Cdd:PTZ00121  1557 LKKAEEKKKAEEAKKAEED--KNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAK----KAEEAKIKAEE--LKKA 1628
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  731 LSERKKKSAQERCQAEA--EMDEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEH 808
Cdd:PTZ00121  1629 EEEKKKVEQLKKKEAEEkkKAEELKKAEEENKIKAAEEAKKAE--EDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEE 1706
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  809 LQQYREVcAQRDAHQQKLAllqDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKK 875
Cdd:PTZ00121  1707 LKKKEAE-EKKKAEELKKA---EEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKK 1769
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
630-868 2.47e-05

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 48.60  E-value: 2.47e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  630 TEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKE--------TDLLRGHVTRLQADLSELREASEQTQTKFKS-EK 700
Cdd:pfam12128  249 FEQLESLELKLSLLHVELKADELRIATEQEERQELKNElksqlrtlEDELAEKIDELNGRLSAADAALAAKRSELEAlDD 328
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  701 QSRRQLELKVTSLEEELTDLRAEKTSLEkNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAE 780
Cdd:pfam12128  329 QKGAFQDDDIETLAADQEQLPSIQSELE-EVEERLDALTGNHQDVTQKYERLKQKISEELNRDLSGNKERLAKIREAKDR 407
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  781 QLTLAQAELQ---SQWEAKCEQLLASARDEhlQQYREVCAQRDAHQQKLALLQDEclaLQAQIAAFTEQKEHMQR----L 853
Cdd:pfam12128  408 QLAAIEEVLQaleSQLRHQLEQQKLEFNEE--QYLLESRLGELKLQLNQATATPE---LLENIEQNDERLERAQEaqeqA 482
                          250
                   ....*....|....*
gi 1242862604  854 EKTKSQAPAGRAAAD 868
Cdd:pfam12128  483 NASVEAAQSELRQLR 497
YhaN COG4717
Uncharacterized protein YhaN, contains AAA domain [Function unknown];
568-830 2.85e-05

Uncharacterized protein YhaN, contains AAA domain [Function unknown];


Pssm-ID: 227061 [Multi-domain]  Cd Length: 984  Bit Score: 48.30  E-value: 2.85e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  568 IIQENERLKQELLEkSSRIEEQNDKIS---DLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQ 644
Cdd:COG4717    538 ITDELPELAVDLLV-QSRIRQHWQQLRkalDQLEAAYEALEGRFAAAEAAMAEWQSEWEEALDELGLSRELSPEQQLDIL 616
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  645 LKMTAH---QKKETELQLQLTDNLKETDLLRGHVTRL----QADLSELREASEQTQTKFKSEKQS---RRQLELKVTSLE 714
Cdd:COG4717    617 STMKDLkklMQKKAELTHQVARLREEQAAFEERVEGLlavlEAQFIDLSTLFCVQRLRVAAELQKeeaRLALEGNIERTK 696
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  715 EELTDLRAEktsLEKNlseRKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ---AAAEQLTLAQAELQS 791
Cdd:COG4717    697 ELNDELRAE---LELH---RKEILDLFDCGTADTEDAFREAAREE-QQLTQRESRLESLEAQlegVAAEAYELSASLDQR 769
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1242862604  792 QWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQ 830
Cdd:COG4717    770 ELKEEELALLEEAIDALDEEVEELHAQVAALSRQIAQLE 808
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
557-855 3.14e-05

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 48.43  E-value: 3.14e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  557 ETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLqTATENTQAKVTEELAAA 636
Cdd:TIGR00618  571 SFSILTQCDNRSKEDIPNLQNITVRLQDLTEKLSEAEDMLACEQHALLRKLQPEQDLQDVRL-HLQQCSQELALKLTALH 649
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  637 TAQVSHLQLKMTAHQKKETELQLQLTD-NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 715
Cdd:TIGR00618  650 ALQLTLTQERVREHALSIRVLPKELLAsRQLALQKMQSEKEQLTYWKEMLAQCQTLLRELETHIEEYDREFNEIENASSS 729
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  716 ELTDLRAEKTSLEKNLSERKKKsAQERCQAEAEMDEiRKSHQE-----ELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ 790
Cdd:TIGR00618  730 LGSDLAAREDALNQSLKELMHQ-ARTVLKARTEAHF-NNNEEVtaalqTGAELSHLAAEIQFFNRLREEDTHLLKTLEAE 807
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1242862604  791 SQWEAKCEQLLASARDEHLQQYREVCAQRDA------HQQKLALLQD-ECLALQAQiaAFTEQKEHMQRLEK 855
Cdd:TIGR00618  808 IGQEIPSDEDILNLQCETLVQEEEQFLSRLEeksatlGEITHQLLKYeECSKQLAQ--LTQEQAKIIQLSDK 877
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
669-860 3.41e-05

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 47.91  E-value: 3.41e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  669 DLLRGHVTRLQADLSELREASEQTQTKFKSE----KQSRRQLE-----LKVTSLEEELTDLRAEKTSLEKNLSERKKKSA 739
Cdd:PRK04778   201 DQLEEELAALEQIMEEIPELLKELQTELPDQlqelKAGYRELVeegyhLDHLDIEKEIQDLKEQIDENLALLEELDLDEA 280
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  740 QERCQA-EAEMDEI----------RKSHQEELDRLRQLLKKARVSTDQAAAE--------QLTLAQAELQSQWEAKCEQL 800
Cdd:PRK04778   281 EEKNEEiQERIDQLydilerevkaRKYVEKNSDTLPDFLEHAKEQNKELKEEidrvkqsyTLNESELESVRQLEKQLESL 360
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1242862604  801 LAsardehlqQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQ----KEHMQRLEKTKSQA 860
Cdd:PRK04778   361 EK--------QYDEITERIAEQEIAYSELQEELEEILKQLEEIEKEqeklSEMLQGLRKDELEA 416
PRK10929 PRK10929
putative mechanosensitive channel protein; Provisional
566-793 3.57e-05

putative mechanosensitive channel protein; Provisional


Pssm-ID: 236798 [Multi-domain]  Cd Length: 1109  Bit Score: 48.13  E-value: 3.57e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  566 QRIIQENERLkqelLEKSSRIEEQNDK---ISDLIerNQRYVEQSnlmmEKRNnSLQTATENTQAKVTEELAAATAQVSH 642
Cdd:PRK10929   109 QEILQVSSQL----LEKSRQAQQEQDRareISDSL--SQLPQQQT----EARR-QLNEIERRLQTLGTPNTPLAQAQLTA 177
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  643 LQLKMTAHQKKETELQL-QLTDNLKE------TDLLRGHVTRLQADLSELReaseqTQTKFKSEKQSRRQLElKVTSLEE 715
Cdd:PRK10929   178 LQAESAALKALVDELELaQLSANNRQelarlrSELAKKRSQQLDAYLQALR-----NQLNSQRQREAERALE-STELLAE 251
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  716 ELTDLRAEKTS-LEKN--LSERKKKSAQercqaeaEMDEIrKSHQEeldrlrqllkkarvstdQAAAEQLTLAQA----E 788
Cdd:PRK10929   252 QSGDLPKSIVAqFKINreLSQALNQQAQ-------RMDLI-ASQQR-----------------QAASQTLQVRQAlntlR 306

                   ....*
gi 1242862604  789 LQSQW 793
Cdd:PRK10929   307 EQSQW 311
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
621-871 4.41e-05

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 47.41  E-value: 4.41e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  621 ATENTQAkVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-EASEQTQTKFKSE 699
Cdd:COG4942     29 AAFSAAA-DDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRkQIADLNARLNALE 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  700 KQSRRQLELkvtsLEEELTDLR--AEKTSLEKNLSErkkKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQA 777
Cdd:COG4942    108 VQEREQRRR----LAEQLAALQrsGRNPPPALLVSP---EDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRAEI 180
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  778 AAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQIAafteqkehmqRLEKTK 857
Cdd:COG4942    181 AAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLN---SELSADQKKLEELRANESRLKNEIA----------SAEAAA 247
                          250
                   ....*....|....
gi 1242862604  858 SQAPAGRAAADPSE 871
Cdd:COG4942    248 AKAREAAAAAEAAA 261
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
569-858 4.44e-05

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 47.73  E-value: 4.44e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  569 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMT 648
Cdd:PRK02224   470 IEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEA-----EDRIERLEERREDLEELIAERRETIEEKRERAEELRE 544
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  649 AHQKKETELQLQltdnlketdllrghvtrlQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLeEELTDLRAEKTSLE 728
Cdd:PRK02224   545 RAAELEAEAEEK------------------REAAAEAEEEAEEAREEVAELNSKLAELKERIESL-ERIRTLLAAIADAE 605
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  729 KNLSERkkksaQERCQAEAEMDEIRKSHQEEL-DRLRQL---LKKARVSTDQAAAEQLTLAQAELqsqweakceqllasa 804
Cdd:PRK02224   606 DEIERL-----REKREALAELNDERRERLAEKrERKRELeaeFDEARIEEAREDKERAEEYLEQV--------------- 665
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1242862604  805 rDEHLQQYREvcaQRDAhqqklalLQDECLALQAQIAAFTEQKEHMQRLEKTKS 858
Cdd:PRK02224   666 -EEKLDELRE---ERDD-------LQAEIGAVENELEELEELRERREALENRVE 708
COG4487 COG4487
Uncharacterized protein, contains DUF2130 domain [Function unknown];
626-874 4.57e-05

Uncharacterized protein, contains DUF2130 domain [Function unknown];


Pssm-ID: 226889 [Multi-domain]  Cd Length: 438  Bit Score: 47.12  E-value: 4.57e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  626 QAKVTEELAAATAQVSHLQLKMTAHQKKE-TELQLQLtDNLKETDLLRGhvtrlQADLSELREASEQTQTKFKSEKQSRR 704
Cdd:COG4487     37 QSRILNTLEEFEKEANEKRAQYRSAKKKElSQLEEQL-INQKKEQKNLF-----NEQIKQFELALQDEIAKLEALELLNL 110
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  705 QLELKVTSLEEELTDLRAEKT-SLEKNLSERKKKSAQERCQAEAEMDEIRKShQEELDRLRQllkKARVstdQAAAEQLT 783
Cdd:COG4487    111 EKDKELELLEKELDELSKELQkQLQNTAEIIEKKRENNKNEERLKFENEKKL-EESLELERE---KFEE---QLHEANLD 183
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  784 LAQAELQSQWEAKCEQLlasardEHLQQYREVCAQRdahqqklalLQDEclALQAQIAAFTEQKEHMQRLEKtksqAPAG 863
Cdd:COG4487    184 LEFKENEEQRESKWAIL------KKLKRRAELGSQQ---------VQGE--ALELPNESFIRSKFPSDINEK----ADKG 242
                          250
                   ....*....|.
gi 1242862604  864 RAAADPSEKVK 874
Cdd:COG4487    243 FRGFDCLNKVP 253
CCDC154 pfam15450
Coiled-coil domain-containing protein 154; CCDC154 is an osteopetrosis-related protein that ...
576-795 5.31e-05

Coiled-coil domain-containing protein 154; CCDC154 is an osteopetrosis-related protein that suppresses cell proliferation by inducing G2/M arrest.


Pssm-ID: 406016 [Multi-domain]  Cd Length: 526  Bit Score: 47.13  E-value: 5.31e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  576 KQELLEKSSRiEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTahqKKET 655
Cdd:pfam15450  113 RKQALQDSER-KGASQEAALRLGKLTGMLKQEEQAREAACSSLQKSQEEASQKVDREVARMQAQGTKLGEEMS---LRFL 188
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  656 ELQLQLTDNLKEtdllrghvtrlqadlSELR-EASEQTQ--TKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLS 732
Cdd:pfam15450  189 KREAKLCGFLQK---------------SFLAlEKRMKASesARLSLEGELREELERRWQLLQELAEERLRALEGQEEQEE 253
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1242862604  733 ERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEA 795
Cdd:pfam15450  254 EHLLEQCRGLDQAVVQLTKFVRQNQVSLNRVLLAEQKARDAKESLEEERAGELAEYLQENLEA 316
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
509-814 5.49e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 47.37  E-value: 5.49e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  509 EARQHNTEIRMAVNKVADKMDHLMTKVEELQK---------------------HSSGNSMllpsMSVTMETSMIMSNIQR 567
Cdd:PRK03918   395 ELEKAKEEIEEEISKITARIGELKKEIKELKKaieelkkakgkcpvcgrelteEHRKELL----EEYTAELKRIEKELKE 470
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  568 IIQENERLKQELLEKSSRIEEQ-----NDKISDLIERNQRYVEQSNLmmEKrnnsLQTATENTQaKVTEELAAATAQVSH 642
Cdd:PRK03918   471 IEEKERKLRKELRELEKVLKKEselikLKELAEQLKELEEKLKKYNL--EE----LEKKAEEYE-KLKEKLIKLKGEIKS 543
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  643 L--QLKMTAHQKKETELQLQLTDNLKE--TDLLR-------GHVTRLQADLSELREASEQ------TQTKFKSEKQSRRQ 705
Cdd:PRK03918   544 LkkELEKLEELKKKLAELEKKLDELEEelAELLKeleelgfESVEELEERLKELEPFYNEylelkdAEKELEREEKELKK 623
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  706 LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQErcqaeaEMDEIRKSHQE---ELDRLRQLLKKARVSTDQAAA--E 780
Cdd:PRK03918   624 LEEELDKAFEELAETEKRLEELRKELEELEKKYSEE------EYEELREEYLElsrELAGLRAELEELEKRREEIKKtlE 697
                          330       340       350
                   ....*....|....*....|....*....|....*
gi 1242862604  781 QLtlaQAELQSQWEAKCE-QLLASARDEhLQQYRE 814
Cdd:PRK03918   698 KL---KEELEEREKAKKElEKLEKALER-VEELRE 728
EzrA COG4477
Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome ...
567-772 5.51e-05

Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 226883 [Multi-domain]  Cd Length: 570  Bit Score: 47.37  E-value: 5.51e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  567 RIIQENERLKQELLEKS-SRIEEQNDKISDLIERNQ--RYVEQSNLMMEKRNNSLQTATENTQAK--VTEELAAATAQVS 641
Cdd:COG4477    240 DMKEEGYHLEHVNIDSRlERLKEQLVENSELLTQLEldEAEEELGLIQEKIESLYDLLEREVEAKnvVEENLPILPDYLE 319
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  642 HLQlKMTAHQKKETELqLQLTDNLKETDLlrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLR 721
Cdd:COG4477    320 KAK-ENNEHLKEEIER-VKESYRLAETEL--GSVRKFEKELKELESVLDEILENIEAQEVAYSELQDNLEEIEKALTDIE 395
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1242862604  722 AEKTSLEKNLSERKKKSAQERcqaeaemdEIRKSHQEELDRLRQLLKKARV 772
Cdd:COG4477    396 DEQEKVQEHLTSLRKDELEAR--------ENLERLKSKLHEIKRYMEKSNL 438
COG1340 COG1340
Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];
577-855 7.49e-05

Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];


Pssm-ID: 224259 [Multi-domain]  Cd Length: 294  Bit Score: 46.21  E-value: 7.49e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  577 QELLEKSSRIEEQndkISDLIERNQRYVEQSNLMMEKR---NNSLQTATENTQAKVtEELAAATAQVSHLQLKMTAHQKK 653
Cdd:COG1340      9 DELELKRKQLKEE---IEELKEKRDELRKEASELAEKRdelNAKVRELREKAQELR-EERDEINEEVQELKEKRDEINAK 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  654 ETELQ---LQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQsrrqlelkvtsLEEELTDLRAEKTSLEKN 730
Cdd:COG1340     85 LQELRkeyRELKEKRNEFNLGGRSIKSLEREIERLEKKQQTSVLTPEEERE-----------LVQKIKELRKELEDAKKA 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  731 LsERKKKSAQERCQAEAEMDEiRKSHQEELDRLRQLLkkarvstdQAAAEQLTLAQAELQsqwEAKCEqllasaRDEHLQ 810
Cdd:COG1340    154 L-EENEKLKELKAEIDELKKK-AREIHEKIQELANEA--------QEYHEEMIKLFEEAD---ELRKE------ADELHE 214
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*
gi 1242862604  811 QYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEK 855
Cdd:COG1340    215 EFVELSKKIDELHEEFRNLQNELRELEKKIKALRAKEKAAKRREK 259
TPR_MLP1_2 pfam07926
TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of ...
623-729 8.37e-05

TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.


Pssm-ID: 400329 [Multi-domain]  Cd Length: 129  Bit Score: 43.37  E-value: 8.37e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  623 ENTQAKVTEELAAATAQVSHLQLKM--------TAHQKKETELQLQLTDnLKETDLLRGHVTRLQADLSELREASEQTQT 694
Cdd:pfam07926    7 ESEIKRLKEEAEDAEAQLQKLQEDLekqaeiakEAQQNYERELVLHAED-IKALQALREELNELKAEIAELKAEAESAKA 85
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 1242862604  695 KFKSEKQSrrqLELKVTSLEEELTDLRAEKTSLEK 729
Cdd:pfam07926   86 ELEESEES---WEEQKERLEKELSELEKRIEDLNE 117
COG5022 COG5022
Myosin heavy chain [General function prediction only];
521-724 9.17e-05

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 46.99  E-value: 9.17e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  521 VNKVADKMDHLMTKVEELQKHSSGNSML---LPSMSVTMETSM---IMSNIQRIIQ-ENERLKQELLEKSSRIEEQNDKI 593
Cdd:COG5022    894 ISSLKLVNLELESEIIELKKSLSSDLIEnleFKTELIARLKKLlnnIDLEEGPSIEyVKLPELNKLHEVESKLKETSEEY 973
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  594 SDLIERNQRYVEQSNLMMEKRNNSLQTATEntQAKVTEELAAATAQVSHLQLKMTAHQK--------KETELQLQLTDNL 665
Cdd:COG5022    974 EDLLKKSTILVREGNKANSELKNFKKELAE--LSKQYGALQESTKQLKELPVEVAELQSaskiisseSTELSILKPLQKL 1051
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1242862604  666 KETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEK 724
Cdd:COG5022   1052 KGLLLLENNQLQARYKALKLRRENSLLDDKQLYQLESTENLLKTINVKDLEVTNRNLVK 1110
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
511-769 9.73e-05

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 401982 [Multi-domain]  Cd Length: 765  Bit Score: 46.74  E-value: 9.73e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  511 RQHNTEIRMAVNKVADKMDHLMTKVEELQKHSS--GNSML-----LPSMSVTMETSMimSNIQRIiqENERLKQELLEKS 583
Cdd:pfam10174  473 KKENKDLKEKVSALQPELTEKESSLIDLKEHASslASSGLkkdskLKSLEIAIEQKK--EECSKL--ENQLKKAHNAEEA 548
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  584 SRI-EEQNDKISDLIERNQRYVEQSN--------LM-----MEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTA 649
Cdd:pfam10174  549 VRTnPEINDRIRLLEQEVARYKEESGkaqaeverLLgilreVENEKNDKDKKIAELESLTLRQMKEQNKKVANIKHKQQE 628
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  650 HQKKETELqlqLTDNLKETDLLRGHVTRLQadLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKtslEK 729
Cdd:pfam10174  629 EKKKGAQL---LEEARRREDNLADNSQHLQ--LEELMGALEKTRQELDATKARLSSTQQSLAEKDGHLTNLRAER---RK 700
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1242862604  730 NLSERKKKSAQERCQAEAEMD------EI----RKSHQEEL-------DRLRQLLKK 769
Cdd:pfam10174  701 QLEEILEMKQEALLAAISEKDaniallELssskKKKTQEEVmalkrekDRLVHQLKQ 757
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
569-802 1.07e-04

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 46.58  E-value: 1.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  569 IQENE-RLKQELLEKSSRIEEQNDKISDLIERNQryvEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKM 647
Cdd:TIGR00606  370 IQSLAtRLELDGFERGPFSERQIKNFHTLVIERQ---EDEAKTAAQLCADLQSKERLKQEQADEIRDEKKGLGRTIELKK 446
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  648 TAHQKKETELQL------QLTDNLKETDLLRGHVTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELTD 719
Cdd:TIGR00606  447 EILEKKQEELKFvikelqQLEGSSDRILELDQELRKAERELSKAEKNSltETLKKEVKSLQNEKADLDRKLRKLDQEMEQ 526
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  720 LRAEKTSLEKNLSERKKKSaqercQAEAEMDEIRKSHQEEL--------------DRLRQLLKKARVSTDQAAAEQLTLA 785
Cdd:TIGR00606  527 LNHHTTTRTQMEMLTKDKM-----DKDEQIRKIKSRHSDELtsllgyfpnkkqleDWLHSKSKEINQTRDRLAKLNKELA 601
                          250       260
                   ....*....|....*....|..
gi 1242862604  786 QAE-----LQSQWEAKCEQLLA 802
Cdd:TIGR00606  602 SLEqnknhINNELESKEEQLSS 623
COG4913 COG4913
Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];
636-831 1.17e-04

Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];


Pssm-ID: 227250 [Multi-domain]  Cd Length: 1104  Bit Score: 46.55  E-value: 1.17e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  636 ATAQVSHLQLKMTAHQKKET-ELQLQLTDNLkeTDLLRGHVTRLQA--DLSELREASEQTQTKFKSEKQSRR-------- 704
Cdd:COG4913    234 AKTAVEQFQDLEGAYEQVEDiKRQIHTLDPL--VQLKNRREKAQQSkdHANALKKALPTVGNRIKKEEQETLvrqftveq 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  705 -QLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLT 783
Cdd:COG4913    312 tQAKSKVESAKIETDRAREMETLAHDNVKQIVGAQHGILSAKREGAVDKRRTISTARAGLDALVKGLGGAAPESAEELLE 391
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 1242862604  784 LAQAELQSqweakCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQD 831
Cdd:COG4913    392 LNNAARLT-----VDEYPAAREALESAGQRNVEDRTRAVDEFKAADQE 434
46 PHA02562
endonuclease subunit; Provisional
509-737 1.21e-04

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 46.16  E-value: 1.21e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  509 EARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMetsmiMSNIQRIIQENERLKQELLEKSSRIEE 588
Cdd:PHA02562   178 ELNQQIQTLDMKIDHIQQQIKTYNKNIEEQRKKNGENIARKQNKYDEL-----VEEAKTIKAEIEELTDELLNLVMDIED 252
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  589 QNDKISDLierNQRYVEQSNLM--------MEKRNNSLQTATEN---TQAKVTEelaaATAQVSHLQLKMTA---HQKKE 654
Cdd:PHA02562   253 PSAALNKL---NTAAAKIKSKIeqfqkvikMYEKGGVCPTCTQQiseGPDRITK----IKDKLKELQHSLEKldtAIDEL 325
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  655 TELQLQLTDNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSER 734
Cdd:PHA02562   326 EEIMDEFNEQSKK-------LLELKNKISTNKQSLITLVDKAKKVKAAIEELQAEFVDNAEELAKLQDELDKIVKTKSEL 398

                   ...
gi 1242862604  735 KKK 737
Cdd:PHA02562   399 VKE 401
GAS pfam13851
Growth-arrest specific micro-tubule binding; This family is the highly conserved central ...
646-791 1.35e-04

Growth-arrest specific micro-tubule binding; This family is the highly conserved central region of a number of metazoan proteins referred to as growth-arrest proteins. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localization of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages. Gas8 is a microtubule-binding protein localized to regions of dynein regulation in mammalian cells.


Pssm-ID: 404693 [Multi-domain]  Cd Length: 200  Bit Score: 44.13  E-value: 1.35e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  646 KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQtqtkFKSEKQSRRQLELKVTSLEEELTDLRAEKt 725
Cdd:pfam13851   34 EIAELKKKEERNEKLMSEIQQENKRLTEPLQKAQEEVEELRKQLEN----YEKDKQSLKNLKARLKVLEKELKDLKWEH- 108
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1242862604  726 sleKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKaRVstdQAAAEQLTLAQAELQS 791
Cdd:pfam13851  109 ---EVLEQRFEKVERERDELYDKFEAAIQDVQQKTGLKNLLLEK-KL---QALGETLEKKEAQLNE 167
PHA03247 PHA03247
large tegument protein UL36; Provisional
934-1119 1.39e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.47  E-value: 1.39e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  934 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 1013
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604 1014 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 1091
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1242862604 1092 PalDPESQGGEAQPPECKQAEDVSSS-GP 1119
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
Filament pfam00038
Intermediate filament protein;
586-852 1.71e-04

Intermediate filament protein;


Pssm-ID: 365827 [Multi-domain]  Cd Length: 313  Bit Score: 44.91  E-value: 1.71e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  586 IEEQNDKISDLIERnQRYVEQSNLMMEkrnnslqtatentqAKVTEELAAATAQVSHLQLkmtAHQKKETELQLQLTDNL 665
Cdd:pfam00038    6 LQELNDRLASYIDK-VRFLEQQNKDLE--------------TKISELRQKKGAEPSRLYS---LYEREIRDLRRQLDQLT 67
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  666 KETDllrghvtRLQADLSELREASEQTQTKFKSEKQSRR---------------------QLELKVTSLEEELTDLraeK 724
Cdd:pfam00038   68 VERA-------RLQLEIDNLRLAAEDFRQKYEDELNLRQsaeadlvglrkdldeatlarvDLEMKVESLQEELAFL---K 137
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  725 TSLEKNLSERKKKSAQErcQAEAEMDEIRKshqeeLDrLRQLLKKARVSTDQAAAeqltLAQAELQSQWEAKCEQL---- 800
Cdd:pfam00038  138 KNHEEEVRELQSQVQDT--QVNVEMDAARK-----LD-LTSALAEIRAQYEEIAA----KNREEAEEWYQSKLEELqqaa 205
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 1242862604  801 ------LASARDEhLQQYREvcaQRDAHQQKLALLQDECLALQAQIAAfTEQKEHMQR 852
Cdd:pfam00038  206 arngdaLRSAKEE-ITELRR---QIQSLEIELQSLKKQKASLERQLAE-TEERYELQL 258
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
580-768 1.79e-04

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 45.83  E-value: 1.79e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  580 LEKSSRIEEQNDKISDLIER--------NQRYVEQ--------SNLMMEK------RNNSLQTATENTQA---------K 628
Cdd:PRK03918   100 LDGSEVLEEGDSSVREWVERlipyhvflNAIYIRQgeidaileSDESREKvvrqilGLDDYENAYKNLGEvikeikrriE 179
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  629 VTEELAAATAQVSHLqLKmtaHQKKETELQLQ----LTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRR 704
Cdd:PRK03918   180 RLEKFIKRTENIEEL-IK---EKEKELEEVLReineISSELPELREELEKLEKEVKELEELKEEIEELEKELESLEGSKR 255
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1242862604  705 QLELKVTSLEEELTDLRAEKTSLEKNLSERK--KKSAQERCQAEAEMDEIRKSHQE---ELDRLRQLLK 768
Cdd:PRK03918   256 KLEEKIRELEERIEELKKEIEELEEKVKELKelKEKAEEYIKLSEFYEEYLDELREiekRLSRLEEEIN 324
COG5281 COG5281
Phage-related minor tail protein [Mobilome: prophages, transposons];
569-864 2.10e-04

Phage-related minor tail protein [Mobilome: prophages, transposons];


Pssm-ID: 227606 [Multi-domain]  Cd Length: 833  Bit Score: 45.40  E-value: 2.10e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  569 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVteELAAATAQVSHLQLKMT 648
Cdd:COG5281    285 QLEQIAALQRAGDTAAAAAAAAEAAAAMDDRTARVKENMGTLETAWDALADAAKKMWDAVL--GIGREDKQAALLAAKLA 362
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  649 AHQKKETELQLQLTDNLKetdLLRGHVTRLQADLSELREASEQTQTKFK--SEKQSRRQLELKVTSLEEELTDLRAEKTS 726
Cdd:COG5281    363 AEKLARVTAQGALNARLK---LAQDDLTQAELNYAAADQAANQEGALNAreDEAEVLSTQEERRDILKNLLADAEKRTAR 439
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  727 LEKnLSERKKKSAQERCQAEAEMDEIRKSHQEELDRlrQLLKKARVSTDQAAAEQLTLA--------------QAELQSQ 792
Cdd:COG5281    440 QEE-LNKALAKAKILQADKAAKAYQEDILQREAQSR--GKTAAAERSQEQMTAALKALLafqqqiadlsgakeKASDQKS 516
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1242862604  793 WEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAfteqkEHMQRLEKTKSQAPAGR 864
Cdd:COG5281    517 LLWKAEEQYALLKEEAKQRQLQEQKALLEHKKETLEYTSQLAELLDQQAD-----RFELSAQAAGSQKERGS 583
MAD pfam05557
Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint ...
531-816 2.22e-04

Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins. The mitotic spindle checkpoint monitors proper attachment of the bipolar spindle to the kinetochores of aligned sister chromatids and causes a cell cycle arrest in prometaphase when failures occur. Multiple components of the mitotic spindle checkpoint have been identified in yeast and higher eukaryotes. In S.cerevisiae, the existence of a Mad1-dependent complex containing Mad2, Mad3, Bub3 and Cdc20 has been demonstrated.


Pssm-ID: 368498 [Multi-domain]  Cd Length: 660  Bit Score: 45.50  E-value: 2.22e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  531 LMTKVEELQK----HSSGNSmllpsmSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQndkiSDLIERNQRYVeq 606
Cdd:pfam05557  281 LSRRIEQLQQreivLKEENS------SLTSSARQLEKARRELEQELAQYLKKIEDLNKKLKRH----KALVRRLQRRV-- 348
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  607 snLMMEKRNNSLQTATEN-----TQAKVTEELAAATAQVSHLQLKMTAHQkkeTELQLQLTDNLKETDLLRGHVTRLQAD 681
Cdd:pfam05557  349 --LLLTKERDGYRAILESydkelTMSNYSPQLLERIEEAEDMTQKMQAHN---EEMEAQLSVAEEELGGYKQQAQTLERE 423
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  682 LSELREASEQTQTKFKSEKQSrrQLELKVTSLEEELTDLRAEKTSLEKNLSER---------KKKSAQERCQAEAEMDEI 752
Cdd:pfam05557  424 LQALRQQESLADPSYSKEEVD--SLRRKLETLELERQRLREQKNELEMELERRclqgdydpkKTKVLHLSMNPAAEAYQQ 501
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1242862604  753 RKSH----QEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHL--------QQYREVC 816
Cdd:pfam05557  502 RKNQleklQAEIERLKRLLKKLEDDLEQVLRLPETTSTMNFKEVLDLRKELESAELKNQRLkevfqakiQEFRDVC 577
EmrA COG1566
Multidrug resistance efflux pump [Defense mechanisms];
744-863 2.49e-04

Multidrug resistance efflux pump [Defense mechanisms];


Pssm-ID: 224482 [Multi-domain]  Cd Length: 352  Bit Score: 44.63  E-value: 2.49e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  744 QAEAEMDEIRKshqeELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ-----SQWEAKCEQLLASARDEHLQQYREVCAQ 818
Cdd:COG1566     95 QAEAALAAAEA----QLRNLRAQLASAQALIAQAEAQDLDQAQNELErraelAQRGVVSREELDRARAALQAAEAALAAA 170
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 1242862604  819 RDAHQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAG 863
Cdd:COG1566    171 QAAQKQNLALLESEVSGAQAQVASAEAALDQAKLdLERTVIRAPVD 216
YqiK COG2268
Uncharacterized membrane protein YqiK, contains Band7/PHB/SPFH domain [Function unknown];
675-907 3.04e-04

Uncharacterized membrane protein YqiK, contains Band7/PHB/SPFH domain [Function unknown];


Pssm-ID: 225177 [Multi-domain]  Cd Length: 548  Bit Score: 44.82  E-value: 3.04e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  675 VTRLQADlSELREASEQTQTKFKSEKQSR----RQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAE---- 746
Cdd:COG2268    216 IAQVLQD-AEIAENEAEKETEIAIAEANRdaklVELEVEQQPAGKTAEQTREVKIILAETEAEVAAWKAETRREAEqaei 294
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  747 -----AEMDEIRK----SHQEELDRLRQLLKKARVSTDQAAAEQ-----LTLAQAELQSQWEAKCEQLLASA--RDEHLQ 810
Cdd:COG2268    295 laeqaIQEEKAQAeqevQHAKALEAREMRVGLIERQKETELEPQersyfINAAQRQAQEEAKAAANIAEAIGaqAEAAVE 374
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  811 QYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKT--KSQAPAGRAAADPSEKVKKIMNQVFQSLRGEF 888
Cdd:COG2268    375 TARETEEAERAEQAALVAAAEAAEQEQVEIAVRAEAAKAEAEAQAAeiKAEAEAIREKGKAEAEAKRALAEAIQVLGDAA 454
                          250
                   ....*....|....*....
gi 1242862604  889 ELEESYDGGTILRTIMHTI 907
Cdd:COG2268    455 AAELFKALVQALPEVAEEA 473
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
565-839 3.23e-04

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 45.13  E-value: 3.23e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  565 IQRIIQENERLKQELLEKSSRIEEQND-KISDLIERNQR-YVEQSNLMMEKRNnSLQTATENTQAKVTEELAAATAQVSh 642
Cdd:pfam12128  667 LQKALKARKQQAETQLQTLDAQLKQLLkKQQAALEEQKEqLRELRTEKQEKWQ-VVVGDLDAQLALLSAAIAALRTQAK- 744
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  643 lqlkmtAHQKketELQLQLTDNLKETDLLRGHVTRLQADLSELrEASEQTQTKFKSE------------KQSRRQLELKV 710
Cdd:pfam12128  745 ------AQLK---ALEEQYKRDLASLGVDPETLKKLKREIETL-ERKIEQIAVRRQEvreyrdfmqetwLLQRPRLATQK 814
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1242862604  711 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLlkkARVSTDqAAAEQLTLAQAELQ 790
Cdd:pfam12128  815 SEIESSAEELRQQLTRLQADTKLRRAKLEQERKASEKQLVRLSENLRKLRCEMSKL---AELAED-ANANQADGSIAERL 890
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1242862604  791 SQweakCEQLL-------------------------ASARDEHLQQYREVCAQRDAHQQKLALLQDEC-----LALQAQ 839
Cdd:pfam12128  891 AQ----LEEFKlkrkrlseqlkkflerfkgvikkhsGSGLAETWESLRDNDSYLGDKGLRLKLLPYLEplldlLAPQKR 965
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structura