NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|355594753|ref|NP_001822|]
View 

clusterin preproprotein [Homo sapiens]

Protein Classification

Clusterin domain-containing protein (domain architecture ID 12014179)

Clusterin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Clusterin pfam01093
Clusterin;
30-445 0e+00

Clusterin;


:

Pssm-ID: 395869 [Multi-domain]  Cd Length: 417  Bit Score: 595.70  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   30 ELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMAL 109
Cdd:pfam01093   1 NLKELSEAGEKYVDEEVKNALIGVKQMKTMMERTEEEHKKLMKTLEKSKEKKEEALKLAKEVEEKLEEEEEVCNESMKAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  110 WEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLL--ENDRQQTHMLDVMQDHFSRASSII 187
Cdd:pfam01093  81 WEECKPCLESTCMKFYTRTCRSGSGLVGRQLEEFFNRISPFSFWINGDRIDDLLvnEEDQEQDAQLDQMEDSFSQLSSDV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  188 DELFQDRFFTREPQDTYHYLPFSLPHRRPHFF-----------FPKSRIVRSlmpfspyepLNFHAMFQPFLEMIHEAQQ 256
Cdd:pfam01093 161 DSLFNRSFFVFKQMQQEFDQAFQSYFMSDTDLtepyffpskepTRKSRFVRS---------WGFPNVFQPFFDFSRSVFE 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  257 AMDIHFHSPAFQHPPTEFIREG-DDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCstnnPSQAKLRRELDESLQVAE 335
Cdd:pfam01093 232 SFSAVITETLDSDQGGLFSKKLpGQDRMLCRELRRNSSGCLKFQDRCEKCQEILSVDC----PSVPELHEELDEALQLAE 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  336 RLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYlRVTTVASHTSDSD-VPSGVTEVVVKLFDSDP 414
Cdd:pfam01093 308 VSTQQYDELLQIVQHHMEDTSSLLDQMNEQFGWVSELANQTQGPENIF-NVTTVVPKSSEGNsSKPGDTKVEVSILDSPP 386
                         410       420       430
                  ....*....|....*....|....*....|.
gi 355594753  415 ITVTVPVEVSRKNPKFMETVAEKALQEYRKK 445
Cdd:pfam01093 387 FTLTVPGELSWDDPKFIEYVAQKALQHYKEH 417
 
Name Accession Description Interval E-value
Clusterin pfam01093
Clusterin;
30-445 0e+00

Clusterin;


Pssm-ID: 395869 [Multi-domain]  Cd Length: 417  Bit Score: 595.70  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   30 ELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMAL 109
Cdd:pfam01093   1 NLKELSEAGEKYVDEEVKNALIGVKQMKTMMERTEEEHKKLMKTLEKSKEKKEEALKLAKEVEEKLEEEEEVCNESMKAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  110 WEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLL--ENDRQQTHMLDVMQDHFSRASSII 187
Cdd:pfam01093  81 WEECKPCLESTCMKFYTRTCRSGSGLVGRQLEEFFNRISPFSFWINGDRIDDLLvnEEDQEQDAQLDQMEDSFSQLSSDV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  188 DELFQDRFFTREPQDTYHYLPFSLPHRRPHFF-----------FPKSRIVRSlmpfspyepLNFHAMFQPFLEMIHEAQQ 256
Cdd:pfam01093 161 DSLFNRSFFVFKQMQQEFDQAFQSYFMSDTDLtepyffpskepTRKSRFVRS---------WGFPNVFQPFFDFSRSVFE 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  257 AMDIHFHSPAFQHPPTEFIREG-DDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCstnnPSQAKLRRELDESLQVAE 335
Cdd:pfam01093 232 SFSAVITETLDSDQGGLFSKKLpGQDRMLCRELRRNSSGCLKFQDRCEKCQEILSVDC----PSVPELHEELDEALQLAE 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  336 RLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYlRVTTVASHTSDSD-VPSGVTEVVVKLFDSDP 414
Cdd:pfam01093 308 VSTQQYDELLQIVQHHMEDTSSLLDQMNEQFGWVSELANQTQGPENIF-NVTTVVPKSSEGNsSKPGDTKVEVSILDSPP 386
                         410       420       430
                  ....*....|....*....|....*....|.
gi 355594753  415 ITVTVPVEVSRKNPKFMETVAEKALQEYRKK 445
Cdd:pfam01093 387 FTLTVPGELSWDDPKFIEYVAQKALQHYKEH 417
CLa smart00035
CLUSTERIN alpha chain;
228-443 1.69e-145

CLUSTERIN alpha chain;


Pssm-ID: 128350  Cd Length: 216  Bit Score: 413.40  E-value: 1.69e-145
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   228 SLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCRE 307
Cdd:smart00035   1 NLMPFPQYWPLNFHDMFQPFFDMIHQAQQAMDTHLHRPPYQFPKQDFAEEHGDDRTVCKEIRHNSTGCLKMKDQCEKCQE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   308 ILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVT 387
Cdd:smart00035  81 ILSVDCSTNNPDQPQLRQELDESLQLAERFTQQYDQLLQSYQKKMLNTSSLLEQLNEQFGWVSQLANLTQGEDQYYLQVT 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 355594753   388 TVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYR 443
Cdd:smart00035 161 TVPSHTSDSSVPSGTTKVVVKLFDSDPITLTIPEEVSADNPKFMETVAEKALQHYR 216
PTZ00009 PTZ00009
heat shock 70 kDa protein; Provisional
26-111 1.50e-03

heat shock 70 kDa protein; Provisional


Pssm-ID: 240227 [Multi-domain]  Cd Length: 653  Bit Score: 40.93  E-value: 1.50e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  26 VSDNELQEMSNQGSKY-----VNKEIQNAVNGVKQ----IKTLIEKTNEERKTLLSNLEEAKKKKEDALN--------ET 88
Cdd:PTZ00009 512 LSKADIDRMVNEAEKYkaedeANRERVEAKNGLENycysMKNTLQDEKVKGKLSDSDKATIEKAIDEALEwleknqlaEK 591
                         90       100
                 ....*....|....*....|...
gi 355594753  89 RESETKLKELPGVCNETMMALWE 111
Cdd:PTZ00009 592 EEFEHKQKEVESVCNPIMTKMYQ 614
 
Name Accession Description Interval E-value
Clusterin pfam01093
Clusterin;
30-445 0e+00

Clusterin;


Pssm-ID: 395869 [Multi-domain]  Cd Length: 417  Bit Score: 595.70  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   30 ELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMAL 109
Cdd:pfam01093   1 NLKELSEAGEKYVDEEVKNALIGVKQMKTMMERTEEEHKKLMKTLEKSKEKKEEALKLAKEVEEKLEEEEEVCNESMKAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  110 WEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLL--ENDRQQTHMLDVMQDHFSRASSII 187
Cdd:pfam01093  81 WEECKPCLESTCMKFYTRTCRSGSGLVGRQLEEFFNRISPFSFWINGDRIDDLLvnEEDQEQDAQLDQMEDSFSQLSSDV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  188 DELFQDRFFTREPQDTYHYLPFSLPHRRPHFF-----------FPKSRIVRSlmpfspyepLNFHAMFQPFLEMIHEAQQ 256
Cdd:pfam01093 161 DSLFNRSFFVFKQMQQEFDQAFQSYFMSDTDLtepyffpskepTRKSRFVRS---------WGFPNVFQPFFDFSRSVFE 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  257 AMDIHFHSPAFQHPPTEFIREG-DDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCstnnPSQAKLRRELDESLQVAE 335
Cdd:pfam01093 232 SFSAVITETLDSDQGGLFSKKLpGQDRMLCRELRRNSSGCLKFQDRCEKCQEILSVDC----PSVPELHEELDEALQLAE 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  336 RLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYlRVTTVASHTSDSD-VPSGVTEVVVKLFDSDP 414
Cdd:pfam01093 308 VSTQQYDELLQIVQHHMEDTSSLLDQMNEQFGWVSELANQTQGPENIF-NVTTVVPKSSEGNsSKPGDTKVEVSILDSPP 386
                         410       420       430
                  ....*....|....*....|....*....|.
gi 355594753  415 ITVTVPVEVSRKNPKFMETVAEKALQEYRKK 445
Cdd:pfam01093 387 FTLTVPGELSWDDPKFIEYVAQKALQHYKEH 417
CLa smart00035
CLUSTERIN alpha chain;
228-443 1.69e-145

CLUSTERIN alpha chain;


Pssm-ID: 128350  Cd Length: 216  Bit Score: 413.40  E-value: 1.69e-145
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   228 SLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCRE 307
Cdd:smart00035   1 NLMPFPQYWPLNFHDMFQPFFDMIHQAQQAMDTHLHRPPYQFPKQDFAEEHGDDRTVCKEIRHNSTGCLKMKDQCEKCQE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   308 ILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVT 387
Cdd:smart00035  81 ILSVDCSTNNPDQPQLRQELDESLQLAERFTQQYDQLLQSYQKKMLNTSSLLEQLNEQFGWVSQLANLTQGEDQYYLQVT 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 355594753   388 TVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYR 443
Cdd:smart00035 161 TVPSHTSDSSVPSGTTKVVVKLFDSDPITLTIPEEVSADNPKFMETVAEKALQHYR 216
CLb smart00030
CLUSTERIN Beta chain;
23-227 3.40e-133

CLUSTERIN Beta chain;


Pssm-ID: 128345  Cd Length: 206  Bit Score: 381.86  E-value: 3.40e-133
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753    23 DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVC 102
Cdd:smart00030   1 DKTVSDNELQEMSTQGSKYINKEIKNALKGVKQIKTLIEKTNKERKSLLSTLEEAKKKKEEALKDTRESEEKLKESQGVC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753   103 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSR 182
Cdd:smart00030  81 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQSHVLDVMEDSFSR 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*.
gi 355594753   183 ASSIIDELFQDRFFTREPQDTYHYLPFSLPHRR-PHFFFPKSRIVR 227
Cdd:smart00030 161 ASSIVDELFQDRFFTREPQDTTFYSPFSSPHRRtEPFFFPKSRLAR 206
PTZ00009 PTZ00009
heat shock 70 kDa protein; Provisional
26-111 1.50e-03

heat shock 70 kDa protein; Provisional


Pssm-ID: 240227 [Multi-domain]  Cd Length: 653  Bit Score: 40.93  E-value: 1.50e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 355594753  26 VSDNELQEMSNQGSKY-----VNKEIQNAVNGVKQ----IKTLIEKTNEERKTLLSNLEEAKKKKEDALN--------ET 88
Cdd:PTZ00009 512 LSKADIDRMVNEAEKYkaedeANRERVEAKNGLENycysMKNTLQDEKVKGKLSDSDKATIEKAIDEALEwleknqlaEK 591
                         90       100
                 ....*....|....*....|...
gi 355594753  89 RESETKLKELPGVCNETMMALWE 111
Cdd:PTZ00009 592 EEFEHKQKEVESVCNPIMTKMYQ 614
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH