NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4504155|ref|NP_002080|]
View 

C-X-C motif chemokine 2 precursor [Homo sapiens]

Protein Classification

CXC family chemokine (domain architecture ID 10084510)

CXC family chemokine such as interleukin-8, also called C-X-C motif chemokine 8, that is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes, and is involved in neutrophil activation

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
40-102 2.52e-25

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


:

Pssm-ID: 238171  Cd Length: 64  Bit Score: 89.63  E-value: 2.52e-25
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4504155   40 ELRCQCLQTLQG-IHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLK 102
Cdd:cd00273   1 ELRCRCIKTTSGfVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
 
Name Accession Description Interval E-value
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
40-102 2.52e-25

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238171  Cd Length: 64  Bit Score: 89.63  E-value: 2.52e-25
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4504155   40 ELRCQCLQTLQG-IHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLK 102
Cdd:cd00273   1 ELRCRCIKTTSGfVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
40-100 2.09e-14

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 61.88  E-value: 2.09e-14
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4504155      40 ELRCqCLQ-TLQGIHLKNIQSVKVksPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM 100
Cdd:smart00199   1 PLRC-CLSyTSKKIPLKRIKSYYP--TSSHCPKPAVIFTTKKGRKVCADPKAKWVQRYIKKL 59
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
41-100 2.03e-12

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 395003  Cd Length: 60  Bit Score: 56.88  E-value: 2.03e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4504155     41 LRCqCLQTLQG-IHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM 100
Cdd:pfam00048   1 SDC-CLRYSSKpIPLKRVKSYEIQPPSSSCPKPAVIFLTKKGRQVCADPKQKWVQRLIKKL 60
 
Name Accession Description Interval E-value
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
40-102 2.52e-25

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238171  Cd Length: 64  Bit Score: 89.63  E-value: 2.52e-25
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4504155   40 ELRCQCLQTLQG-IHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLK 102
Cdd:cd00273   1 ELRCRCIKTTSGfVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
Chemokine cd00169
Chemokine: small cytokines, including a number of secreted growth factors and interferons ...
44-101 6.35e-17

Chemokine: small cytokines, including a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; distinguished from other cytokines by their receptors, which are G-protein coupled receptors; divided into 4 subfamilies based on the arrangement of the two N-terminal cysteines; some members can bind multiple receptors and many chemokine receptors can bind more than one chemokine; this redundancy allows precise control in stimulating the immune system and in contributing to the homeostasis of a cell; when expressed inappropriately, chemokines play a role in autoimmune diseases, vascular irregularities, graft rejection, neoplasia, and allergies; exist as monomers, dimers and multimers, but are believed to function as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine_CXC (cd00273), Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for chemokine subgroups.


Pssm-ID: 238098  Cd Length: 59  Bit Score: 68.52  E-value: 6.35e-17
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 4504155   44 QCLQTL-QGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKML 101
Cdd:cd00169   1 CCLKYTsKPIPPKNIKSYRVQEAGGHCSIPAVIFTTKKGRKVCADPKEPWVKDLIQKLD 59
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
40-100 2.09e-14

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 61.88  E-value: 2.09e-14
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4504155      40 ELRCqCLQ-TLQGIHLKNIQSVKVksPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM 100
Cdd:smart00199   1 PLRC-CLSyTSKKIPLKRIKSYYP--TSSHCPKPAVIFTTKKGRKVCADPKAKWVQRYIKKL 59
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
41-100 2.03e-12

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 395003  Cd Length: 60  Bit Score: 56.88  E-value: 2.03e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4504155     41 LRCqCLQTLQG-IHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM 100
Cdd:pfam00048   1 SDC-CLRYSSKpIPLKRVKSYEIQPPSSSCPKPAVIFLTKKGRQVCADPKQKWVQRLIKKL 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH