NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4505595|ref|NP_002566|]
View 

plasminogen activator inhibitor 2 [Homo sapiens]

Protein Classification

PAI-2 domain-containing protein (domain architecture ID 10114489)

PAI-2 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PAI-2 cd02058
Plasminogen Activator Inhibitor-2 (PAI-2). PAI-2 is a serine protease inhibitor that belongs ...
4-415 0e+00

Plasminogen Activator Inhibitor-2 (PAI-2). PAI-2 is a serine protease inhibitor that belongs to the ov-serpin branch of the serpin superfamily. It is is an effective inhibitor of urinary plasminogen activator (urokinase or uPA) and is involved in cell differentiation, tissue growth and regeneration.


:

Pssm-ID: 239013  Cd Length: 380  Bit Score: 684.94  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAvtpmtpenftscgfmq 83
Cdd:cd02058   1 LSAANTSFALNLFKKLAESSPTKNIFFSPWSISSALAMVYLGAKGNTAAQMAKVLQFNEVGGNS---------------- 64
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqkgsypdailqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAE 163
Cdd:cd02058  65 -----------------EDIHSGFQSLLSEINKPGTNYLLKSANRLYGEKTYPFLEKFLQLTQKYYQAEPQAVDFVEAAE 127
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNI 243
Cdd:cd02058 128 QARKEINSWVERQTEGKIQNLLPPGSVDSLTRLVLVNAIYFKGNWEEKFLKENTRERPFRLNKNTTKPVQMMFLKKKFPI 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  244 GYIEDLKAQILELPYAG-DVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRS 322
Cdd:cd02058 208 TYIEELKAQVLELPYVGkELSMFILLPDEIEDVTTGLEKLEKELTYEKLNEWTSPEMMEEYEVEVYLPKFKLEESYDLKS 287
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  323 ILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKI 402
Cdd:cd02058 288 TLSSMGMEDAFDPGKADFSGMSSANDLFLSKVFHKAFVEVNEEGTEAAAATAAIMMLRCLMPSPRFNADHPFLFFIRHNK 367
                       410
                ....*....|...
gi 4505595  403 TNCILFFGRFSSP 415
Cdd:cd02058 368 TNTILFFGRFCSP 380
 
Name Accession Description Interval E-value
PAI-2 cd02058
Plasminogen Activator Inhibitor-2 (PAI-2). PAI-2 is a serine protease inhibitor that belongs ...
4-415 0e+00

Plasminogen Activator Inhibitor-2 (PAI-2). PAI-2 is a serine protease inhibitor that belongs to the ov-serpin branch of the serpin superfamily. It is is an effective inhibitor of urinary plasminogen activator (urokinase or uPA) and is involved in cell differentiation, tissue growth and regeneration.


Pssm-ID: 239013  Cd Length: 380  Bit Score: 684.94  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAvtpmtpenftscgfmq 83
Cdd:cd02058   1 LSAANTSFALNLFKKLAESSPTKNIFFSPWSISSALAMVYLGAKGNTAAQMAKVLQFNEVGGNS---------------- 64
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqkgsypdailqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAE 163
Cdd:cd02058  65 -----------------EDIHSGFQSLLSEINKPGTNYLLKSANRLYGEKTYPFLEKFLQLTQKYYQAEPQAVDFVEAAE 127
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNI 243
Cdd:cd02058 128 QARKEINSWVERQTEGKIQNLLPPGSVDSLTRLVLVNAIYFKGNWEEKFLKENTRERPFRLNKNTTKPVQMMFLKKKFPI 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  244 GYIEDLKAQILELPYAG-DVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRS 322
Cdd:cd02058 208 TYIEELKAQVLELPYVGkELSMFILLPDEIEDVTTGLEKLEKELTYEKLNEWTSPEMMEEYEVEVYLPKFKLEESYDLKS 287
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  323 ILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKI 402
Cdd:cd02058 288 TLSSMGMEDAFDPGKADFSGMSSANDLFLSKVFHKAFVEVNEEGTEAAAATAAIMMLRCLMPSPRFNADHPFLFFIRHNK 367
                       410
                ....*....|...
gi 4505595  403 TNCILFFGRFSSP 415
Cdd:cd02058 368 TNTILFFGRFCSP 380
SERPIN smart00093
SERine Proteinase INhibitors;
13-415 1.14e-168

SERine Proteinase INhibitors;


Pssm-ID: 214513  Cd Length: 359  Bit Score: 476.29  E-value: 1.14e-168
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595      13 LNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGanavtpmTPEnftscgfmqqiqkgsypd 92
Cdd:smart00093   1 FDLYKELAKESPDKNIFFSPVSISSALAMLSLGAKGSTATQILEVLGFNLTE-------TSE------------------ 55
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595      93 ailqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSW 172
Cdd:smart00093  56 --------ADIHQGFQHLLHLLNRPDSQLELKTANALFVDKSLKLKDSFLEDIKKLYGAEVQSVDFSDKAEEAKKQINDW 127
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     173 VKTQTKGKIPNLLPEgsVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREK-LNIGYIEDLKA 251
Cdd:smart00093 128 VEKKTQGKIKDLLSD--LDSDTRLVLVNAIYFKGKWKTPFDPELTREEDFHVDETTTVKVPMMSQTGRtFNYGHDEELNC 205
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     252 QILELPYAGDVSMFLLLPDEiadvsTGLELLESEITYDKLNKWTSkdKMAEDEVEVYIPQFKLEEHYELRSILRSMGMED 331
Cdd:smart00093 206 QVLELPYKGNASMLIILPDE-----GGLEKLEKALTPETLKKWMK--SLTKRSVELYLPKFKIEGTYDLKDVLEKLGITD 278
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     332 AFNkGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHggPQFVADHPFLFLIMHKITNCILFFGR 411
Cdd:smart00093 279 LFS-NKADLSGISEDKDLKVSKVLHKAVLEVNEEGTEAAAATGVIAVPRSLP--PEFKANRPFLFLIRDNKTGSILFMGK 355

                   ....
gi 4505595     412 FSSP 415
Cdd:smart00093 356 VVNP 359
Serpin pfam00079
Serpin (serine protease inhibitor); Structure is a multi-domain fold containing a bundle of ...
7-415 1.13e-166

Serpin (serine protease inhibitor); Structure is a multi-domain fold containing a bundle of helices and a beta sandwich.


Pssm-ID: 333821  Cd Length: 369  Bit Score: 471.72  E-value: 1.13e-166
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595      7 ANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVganavtpmtpenftscgfmqqiq 86
Cdd:pfam00079   2 ANNDFAFDLYKQLAKSNPDKNIFFSPLSISTALAMLYLGAKGETAEQLLEVLGFNLL----------------------- 58
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     87 kgsypdailqaqAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcAEEAR 166
Cdd:pfam00079  59 ------------DEEEIHQGFQSLLQSLNKPDSGYELKLANALFVDKGLKLKPDFLQLAKKYYGAEVESVDFSD-PEEAR 125
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    167 KKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYI 246
Cdd:pfam00079 126 KQINSWVEKQTNGKIKDLLPEGSLDPDTRLVLVNAIYFKGKWKKPFDPEDTREEPFYVNNGTTVKVPMMSQKGQFRYAED 205
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    247 EDLKAQILELPYAGDVSMFLLLPDEIadvsTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRS 326
Cdd:pfam00079 206 EELGCKVLELPYKGNLSMLIILPDEG----DGLEELEKSLTAELLLEWTSSLKPRKVREELSLPKFKIEYSYDLKDVLKK 281
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    327 MGMEDAFNkGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCI 406
Cdd:pfam00079 282 LGITDAFS-SEADFSGISSDEPLYVSEVVHKAFIEVNEEGTEAAAATGVIIVPTAPSPPPEFKADRPFLFLIRDNKTGSI 360

                  ....*....
gi 4505595    407 LFFGRFSSP 415
Cdd:pfam00079 361 LFMGRVVNP 369
SERPIN COG4826
Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones];
3-415 9.02e-100

Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227163  Cd Length: 410  Bit Score: 302.93  E-value: 9.02e-100
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    3 DLCVANTLFALNLFKHLAKA-SPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFnevganavtpmtPENFTscgf 81
Cdd:COG4826  37 DIAAANNAFAFDLYSELAKQeGEAENILFSPYSVSAAMAMCYEGAEGSTKEQMSNVFYF------------PINKT---- 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   82 mqqiqkgsypdailqaqaadKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEC 161
Cdd:COG4826 101 --------------------VLKVREKSLNDKINSPNDSYELETANALWVQEDYPLKENYVNNVRNYYDAEVTNLDFVNK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  162 AEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKL 241
Cdd:COG4826 161 PDASRDTINKWVEEKTNGKIKDLVPEDYIGPDTRLVLTNAIYFNGKWWPEFDKQMTGKRTFYPAKGEDKSVDMMSICGDF 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  242 NigYIEDLKAQILELPYAGD-VSMFLLLPDEiadvsTGLELLESEITYDKLNKWTSkDKMAEDEVEVYIPQFKLEEHYEL 320
Cdd:COG4826 241 N--YGETSKAKIVELPYKGDdLSMYIVLPKD-----NNITEFENNFTLEKYTELKS-NMEDQDEVEVEIPKFKFETKTEL 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  321 RSILRSMGMEDAFNKgRANFSGMSErNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVM--TGRTGhGGPQFVADHPFLFLI 398
Cdd:COG4826 313 KDALIEMGVVDAFEN-TANFSGISD-RRLEISDVFHQAFIDVDEEGTEAAAATAVVFkaVCAKG-GWVEFVVDHPFLFVI 389
                       410
                ....*....|....*..
gi 4505595  399 MHKITNCILFFGRFSSP 415
Cdd:COG4826 390 EDRRSGCILFIGKVVNP 406
PHA02948 PHA02948
serine protease inhibitor-like protein; Provisional
164-415 7.75e-26

serine protease inhibitor-like protein; Provisional


Pssm-ID: 165258  Cd Length: 373  Bit Score: 107.44  E-value: 7.75e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   164 EARKKINSWVktQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTpVQMMYLREKL-- 241
Cdd:PHA02948 135 DAVNKINSIV--ERRSGMSNVVDSTMLDNNTLWAIINTIYFKGTWQYPFDITKTHNASFTNKYGTKT-VPMMNVVTKLqg 211
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   242 NIGYIEDLKAQILELPYA-GDVSMFLLLPDEIADVStglelleSEITYDKLNKWTSKdkMAEDEVEVYIPQFKLEEHYEL 320
Cdd:PHA02948 212 NTITIDDEEYDMVRLPYKdANISMYLAIGDNMTHFT-------DSITAAKLDYWSSQ--LGNKVYNLKLPRFSIENKRDI 282
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   321 RSILRSMGmEDAFNKGRANFSGMSeRNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFvaDHPFLFLIMH 400
Cdd:PHA02948 283 KSIAEMMA-PSMFNPDNASFKHMT-RDPLYIYKMFQNAKIDVDEQGTVAEASTIMVATARSSPEELEF--NTPFVFIIRH 358
                        250
                 ....*....|....*
gi 4505595   401 KITNCILFFGRFSSP 415
Cdd:PHA02948 359 DITGFILFMGKVESP 373
 
Name Accession Description Interval E-value
PAI-2 cd02058
Plasminogen Activator Inhibitor-2 (PAI-2). PAI-2 is a serine protease inhibitor that belongs ...
4-415 0e+00

Plasminogen Activator Inhibitor-2 (PAI-2). PAI-2 is a serine protease inhibitor that belongs to the ov-serpin branch of the serpin superfamily. It is is an effective inhibitor of urinary plasminogen activator (urokinase or uPA) and is involved in cell differentiation, tissue growth and regeneration.


Pssm-ID: 239013  Cd Length: 380  Bit Score: 684.94  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAvtpmtpenftscgfmq 83
Cdd:cd02058   1 LSAANTSFALNLFKKLAESSPTKNIFFSPWSISSALAMVYLGAKGNTAAQMAKVLQFNEVGGNS---------------- 64
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqkgsypdailqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAE 163
Cdd:cd02058  65 -----------------EDIHSGFQSLLSEINKPGTNYLLKSANRLYGEKTYPFLEKFLQLTQKYYQAEPQAVDFVEAAE 127
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNI 243
Cdd:cd02058 128 QARKEINSWVERQTEGKIQNLLPPGSVDSLTRLVLVNAIYFKGNWEEKFLKENTRERPFRLNKNTTKPVQMMFLKKKFPI 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  244 GYIEDLKAQILELPYAG-DVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRS 322
Cdd:cd02058 208 TYIEELKAQVLELPYVGkELSMFILLPDEIEDVTTGLEKLEKELTYEKLNEWTSPEMMEEYEVEVYLPKFKLEESYDLKS 287
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  323 ILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKI 402
Cdd:cd02058 288 TLSSMGMEDAFDPGKADFSGMSSANDLFLSKVFHKAFVEVNEEGTEAAAATAAIMMLRCLMPSPRFNADHPFLFFIRHNK 367
                       410
                ....*....|...
gi 4505595  403 TNCILFFGRFSSP 415
Cdd:cd02058 368 TNTILFFGRFCSP 380
ov-serpin cd02044
ovalbumin family of serpins (ov-serpins). Family of closely related proteins, whose members ...
4-415 0e+00

ovalbumin family of serpins (ov-serpins). Family of closely related proteins, whose members can be secreted (ovalbumin), cytosolic (leukocyte elastase inhibitor, LEI), or targeted to both compartments (plasminogen activator inhibitor 2, PAI-2). This subgroup corresponds to clade B of the serpin superfamily. In general, serpins exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants can cause blood clotting disorders, emphysema, cirrhosis, and dementia.


Pssm-ID: 238999  Cd Length: 370  Bit Score: 626.85  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVganavtpmtpenftscgfmq 83
Cdd:cd02044   1 ICLANSAFAVDVFKELSKKSALQNVFFSPIAIMSSLAMVYLGAKGSTANQIGKVLHFDNV-------------------- 60
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqkgsypdailqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAE 163
Cdd:cd02044  61 -----------------KDVHSSFQTLLSDINKLNSFYSLKLVNRLYGEKRYNFLPEFLSSTKKPYAKELETVDFKDKAE 123
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNI 243
Cdd:cd02044 124 ETRGQINSWIKDQTKGKIENLLPENSVDSQTAMVVVNAAYFKGKWMKKFSEEETKESPFRVNKTETKPVQMMYMEATFNM 203
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  244 GYIEDLKAQILELPYA-GDVSMFLLLPDEIadvsTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRS 322
Cdd:cd02044 204 GNIESLKMKILELPFAnKDLSMFILLPDEV----TGLEKLESEINYEKLNKWTSPSTMAEAKVKVYLPRFKMEKMYDLKS 279
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  323 ILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTghGGPQFVADHPFLFLIMHKI 402
Cdd:cd02044 280 VLESLGMKDAFSEGRANFSGMSETKGLALSNVIHKASLEINEDGTEAAEVTGAVMLQRS--VKEEFNADHPFLFIIRHNK 357
                       410
                ....*....|...
gi 4505595  403 TNCILFFGRFSSP 415
Cdd:cd02044 358 TNCILFFGKFSSP 370
SERPIN smart00093
SERine Proteinase INhibitors;
13-415 1.14e-168

SERine Proteinase INhibitors;


Pssm-ID: 214513  Cd Length: 359  Bit Score: 476.29  E-value: 1.14e-168
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595      13 LNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGanavtpmTPEnftscgfmqqiqkgsypd 92
Cdd:smart00093   1 FDLYKELAKESPDKNIFFSPVSISSALAMLSLGAKGSTATQILEVLGFNLTE-------TSE------------------ 55
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595      93 ailqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSW 172
Cdd:smart00093  56 --------ADIHQGFQHLLHLLNRPDSQLELKTANALFVDKSLKLKDSFLEDIKKLYGAEVQSVDFSDKAEEAKKQINDW 127
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     173 VKTQTKGKIPNLLPEgsVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREK-LNIGYIEDLKA 251
Cdd:smart00093 128 VEKKTQGKIKDLLSD--LDSDTRLVLVNAIYFKGKWKTPFDPELTREEDFHVDETTTVKVPMMSQTGRtFNYGHDEELNC 205
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     252 QILELPYAGDVSMFLLLPDEiadvsTGLELLESEITYDKLNKWTSkdKMAEDEVEVYIPQFKLEEHYELRSILRSMGMED 331
Cdd:smart00093 206 QVLELPYKGNASMLIILPDE-----GGLEKLEKALTPETLKKWMK--SLTKRSVELYLPKFKIEGTYDLKDVLEKLGITD 278
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     332 AFNkGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHggPQFVADHPFLFLIMHKITNCILFFGR 411
Cdd:smart00093 279 LFS-NKADLSGISEDKDLKVSKVLHKAVLEVNEEGTEAAAATGVIAVPRSLP--PEFKANRPFLFLIRDNKTGSILFMGK 355

                   ....
gi 4505595     412 FSSP 415
Cdd:smart00093 356 VVNP 359
Serpin pfam00079
Serpin (serine protease inhibitor); Structure is a multi-domain fold containing a bundle of ...
7-415 1.13e-166

Serpin (serine protease inhibitor); Structure is a multi-domain fold containing a bundle of helices and a beta sandwich.


Pssm-ID: 333821  Cd Length: 369  Bit Score: 471.72  E-value: 1.13e-166
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595      7 ANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVganavtpmtpenftscgfmqqiq 86
Cdd:pfam00079   2 ANNDFAFDLYKQLAKSNPDKNIFFSPLSISTALAMLYLGAKGETAEQLLEVLGFNLL----------------------- 58
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595     87 kgsypdailqaqAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcAEEAR 166
Cdd:pfam00079  59 ------------DEEEIHQGFQSLLQSLNKPDSGYELKLANALFVDKGLKLKPDFLQLAKKYYGAEVESVDFSD-PEEAR 125
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    167 KKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYI 246
Cdd:pfam00079 126 KQINSWVEKQTNGKIKDLLPEGSLDPDTRLVLVNAIYFKGKWKKPFDPEDTREEPFYVNNGTTVKVPMMSQKGQFRYAED 205
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    247 EDLKAQILELPYAGDVSMFLLLPDEIadvsTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRS 326
Cdd:pfam00079 206 EELGCKVLELPYKGNLSMLIILPDEG----DGLEELEKSLTAELLLEWTSSLKPRKVREELSLPKFKIEYSYDLKDVLKK 281
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    327 MGMEDAFNkGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCI 406
Cdd:pfam00079 282 LGITDAFS-SEADFSGISSDEPLYVSEVVHKAFIEVNEEGTEAAAATGVIIVPTAPSPPPEFKADRPFLFLIRDNKTGSI 360

                  ....*....
gi 4505595    407 LFFGRFSSP 415
Cdd:pfam00079 361 LFMGRVVNP 369
SERPIN cd00172
SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from ...
7-412 9.46e-154

SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants have been associated with blood clotting disorders, emphysema, cirrhosis, and dementia.


Pssm-ID: 238101  Cd Length: 364  Bit Score: 438.61  E-value: 9.46e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    7 ANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNevganavtpmtpenftscgfmqqiq 86
Cdd:cd00172   1 ANNDFALDLYKQLAKSEPDENVVFSPLSIASALALLYLGAGGETREQLRKVLGLP------------------------- 55
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   87 kgsypdailqAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcAEEAR 166
Cdd:cd00172  56 ----------SLDDEDVHQAFKSLLSSLKDSEKGVELKLANRLFVQKGLTVKEDFLDLAKKYYDAEVESVDFAN-PEAAA 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  167 KKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYI 246
Cdd:cd00172 125 AQINNWVEEKTNGKIKDLLSPDALDPDTRLVLVNAIYFKGKWKTPFDPELTRKRPFYVSEGESVQVPMMYQTGKFRYAED 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  247 EDLKAQILELPYAG-DVSMFLLLPDEiadvSTGLELLESEITYDKLNKWTSkdKMAEDEVEVYIPQFKLEEHYELRSILR 325
Cdd:cd00172 205 EELDAQVLELPYKGsDLSMLIILPKE----VTGLAELEEKLSAEKLDDLLS--NLKEREVEVTLPKFKIESSLDLKEVLQ 278
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  326 SMGMEDAFNKGrANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNC 405
Cdd:cd00172 279 ALGITDLFSPS-ADLSSISSDEPLYVSKVIHKAFIEVNEEGTEAAAATAVSIVPRRPSPPVEFKADRPFLFLIRDDTTGT 357

                ....*..
gi 4505595  406 ILFFGRF 412
Cdd:cd00172 358 ILFLGRV 364
ovalbumin_like cd02059
The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 ...
4-415 1.23e-149

The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily. Ovalbumin, the major protein component of avian egg white, is a non-inhibitory member of SERine Proteinase INhibitorS (serpins). In contrast, SCCA1 inhibits cysteine proteinases such as cathepsin S, K, L, and papain, a so called cross-class serpin.


Pssm-ID: 239014  Cd Length: 389  Bit Score: 429.53  E-value: 1.23e-149
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANavtpmtpenftscgfmq 83
Cdd:cd02059   1 LSAANTEFCFDLFKELKKNHKNKNIFFSPLSISSALGMVLLGARDDTAAQIEKVLHFDHASGS----------------- 63
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAE 163
Cdd:cd02059  64 ---GSSKPAASAQCNQSGGVHSQFKDLLSQINKPNDDYELSIANRLYGEKTYPFHQEYLDCVEKLYRAKLEPVDFQNAAE 140
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNI 243
Cdd:cd02059 141 ASRKKINSWVESQTNGKIKNLFGKGTIDSSTVLVLVNAIYFKGKWEKKFEKENTVDAPFKLNENENKPVQMMYQIGKFKL 220
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  244 GYIEDLKAQILELPYA-GDVSMFLLLPDEIAdvstGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRS 322
Cdd:cd02059 221 ASIEEPKMKILELPYAgGGLSMIVLLPDEIS----GLEQLESKLTYEKLMEWTSSENMRERKVEVYLPRFKLEEKYNLKS 296
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  323 ILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKI 402
Cdd:cd02059 297 VLKAMGMTDIFSESKADLSGISSSKSLYLSKAIHKSYVEVNEEGTEAAAATGAGIVEKSLPVSEEFRADHPFLFFIRHNK 376
                       410
                ....*....|...
gi 4505595  403 TNCILFFGRFSSP 415
Cdd:cd02059 377 TNTILFFGRFSSP 389
maspin_like cd02057
Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a ...
4-415 2.44e-102

Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages. Maspin has tumor suppressing activity against breast and prostate cancer. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones.


Pssm-ID: 239012  Cd Length: 372  Bit Score: 308.37  E-value: 2.44e-102
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFnevganavtpmtpENFTSCGFmq 83
Cdd:cd02057   1 LQLANTAFAVDLFKKLCEKEPTGNVVFSPICLSTSLALAQVGAKGDTANEIGKVLHF-------------ENVKDVPF-- 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqkgsypdailqaqaadkihsSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAE 163
Cdd:cd02057  66 ----------------------GFQTVTSDVSKLSSFYSLKLIKRLYVDKSLNLSTDFINSTKRPYPKELETVDFKDKLE 123
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNI 243
Cdd:cd02057 124 ETRGQINNSIKELTDGHFENILNENSVNDQTKILVVNAAYFVGNWMKKFPESETKECPFRVNKTETKPVQMMNLEATFSM 203
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  244 GYIEDLKAQILELPYAGD-VSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRS 322
Cdd:cd02057 204 GYIDELNTKILELPFQNKhLSMLILLPKDIEDESTGLEKLEKQLTSESLSQWTNPSMMANAKVKVSLPKFKVEKMIDLKA 283
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  323 ILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGgvmtGRTGHGGPQFVADHPFLFLIMHKI 402
Cdd:cd02057 284 MLESLGLKHIFNEDASDFSGMSETKGVALSNVIHKVCLEVNEDGGESIEVPG----ARILQHKDEFNADHPFIFIIRHNK 359
                       410
                ....*....|...
gi 4505595  403 TNCILFFGRFSSP 415
Cdd:cd02057 360 TRNIIFFGRFCSP 372
SERPIN COG4826
Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones];
3-415 9.02e-100

Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227163  Cd Length: 410  Bit Score: 302.93  E-value: 9.02e-100
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    3 DLCVANTLFALNLFKHLAKA-SPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFnevganavtpmtPENFTscgf 81
Cdd:COG4826  37 DIAAANNAFAFDLYSELAKQeGEAENILFSPYSVSAAMAMCYEGAEGSTKEQMSNVFYF------------PINKT---- 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   82 mqqiqkgsypdailqaqaadKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEC 161
Cdd:COG4826 101 --------------------VLKVREKSLNDKINSPNDSYELETANALWVQEDYPLKENYVNNVRNYYDAEVTNLDFVNK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  162 AEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKL 241
Cdd:COG4826 161 PDASRDTINKWVEEKTNGKIKDLVPEDYIGPDTRLVLTNAIYFNGKWWPEFDKQMTGKRTFYPAKGEDKSVDMMSICGDF 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  242 NigYIEDLKAQILELPYAGD-VSMFLLLPDEiadvsTGLELLESEITYDKLNKWTSkDKMAEDEVEVYIPQFKLEEHYEL 320
Cdd:COG4826 241 N--YGETSKAKIVELPYKGDdLSMYIVLPKD-----NNITEFENNFTLEKYTELKS-NMEDQDEVEVEIPKFKFETKTEL 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  321 RSILRSMGMEDAFNKgRANFSGMSErNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVM--TGRTGhGGPQFVADHPFLFLI 398
Cdd:COG4826 313 KDALIEMGVVDAFEN-TANFSGISD-RRLEISDVFHQAFIDVDEEGTEAAAATAVVFkaVCAKG-GWVEFVVDHPFLFVI 389
                       410
                ....*....|....*..
gi 4505595  399 MHKITNCILFFGRFSSP 415
Cdd:COG4826 390 EDRRSGCILFIGKVVNP 406
alpha-1-antitrypsin_like cd02056
alpha-1-antitrypsin_like. This family contains a variety of different members of clade A of ...
7-411 3.38e-95

alpha-1-antitrypsin_like. This family contains a variety of different members of clade A of the serpin superfamily. They include the classical serine proteinase inhibitors, alpha-1-antitrypsin and alpha-1-antichymotrypsin, protein C inhibitor, kallistatin, and noninhibitory serpins, like corticosteroid and thyroxin binding globulins. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants have been associated with blood clotting disorders, emphysema, cirrhosis, and dementia.


Pssm-ID: 239011  Cd Length: 361  Bit Score: 289.54  E-value: 3.38e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    7 ANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNevganavtpmtpenftscgfmqqiq 86
Cdd:cd02056   1 ANADFAFRLYRQLASESPSKNIFFSPVSISTALAMLSLGARSSTLAQILEGLGFN------------------------- 55
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   87 kgsypdaiLQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcAEEAR 166
Cdd:cd02056  56 --------LTEISEEEIHQGFQHLLHLLNQPDSGLQLNMGNALFLDKRLKPLDKFLEDVKHLYESEAFSTDFQD-SAEAK 126
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  167 KKINSWVKTQTKGKIPNLLPEgsVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYI 246
Cdd:cd02056 127 KQINDYVEKKTHGKIVDLVKD--LDSDTVMVLVNYIYFKGKWEKPFDPELTQEEDFFVDEKTTVKVPMMHQTGRYDYLHD 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  247 EDLKAQILELPYAGDVSMFLLLPDEiadvsTGLELLESEITYDKLNKWtsKDKMAEDEVEVYIPQFKLEEHYELRSILRS 326
Cdd:cd02056 205 SELSCTVVQMPYKGNATAFFVLPDE-----GKMKQVEAALSRDTLKKW--SKLLSKRSVDLYLPKFSISGTYNLKDILPK 277
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  327 MGMEDAFNKgRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHgGPQFVADHPFLFLIMHKITNCI 406
Cdd:cd02056 278 MGITDVFSD-KADLSGITEQPNLKVSKAVHKAVLDVDEKGTEAAAATGVEITPMSAL-PPILKFNRPFLLLIFDRTTESI 355

                ....*
gi 4505595  407 LFFGR 411
Cdd:cd02056 356 LFLGK 360
antithrombin-III_like cd02045
Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of ...
3-411 2.00e-87

Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation. It is the most important anticoagulant molecule in mammalian circulation systems, controlled by its interaction with the co-factor, heparin, which accelerates its interaction with target proteases, such as thrombin and factor Xa. This subgroup corresponds to clade C of the serpin superfamily.


Pssm-ID: 239000  Cd Length: 381  Bit Score: 270.19  E-value: 2.00e-87
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    3 DLCVANTLFALNLFKHLAKA-SPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVganavtpmtpenftscgf 81
Cdd:cd02045   4 ELSKANSRFALAFYKHLADSkSNDENIFLSPLSISTAFAMTKLGACNNTLEQLMEVFQFDTI------------------ 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   82 mqqiqkgsypdailQAQAADKIHSSFRSLSSAI----NASTGnylLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVD 157
Cdd:cd02045  66 --------------SEKTSDQVHFFFAKLNCRLyrkaNKSSE---LISANRLFGDKSLTFNETYQDISEIVYGAKLWPLD 128
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  158 FLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYL 237
Cdd:cd02045 129 FKEKPELSRITINEWIANKTENRITDVIPEGAIDTNTVLVLVNAIYFKGLWKSKFDKENTRKDLFHKAPGEKCPVPMMYQ 208
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  238 REKLNIGYIEDLKAQILELPYAG-DVSMFLLLPDEiadvSTGLELLESEITYDKLNKWTskDKMAEDEVEVYIPQFKLEE 316
Cdd:cd02045 209 ESKFRYAKIPEDKVQVLELPYKGdDITMVLILPKE----GTTLSEVEQNLTLDKLQGWL--DAMKETTLAVQIPRFRVED 282
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  317 HYELRSILRSMGMEDAFNKGRANFSGM--SERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRT-GHGGPQFVADHP 393
Cdd:cd02045 283 SFSVKEQLQKMGLEDLFSPENAKLPGIvaGGRTDLYVSDAFHKAFLEVNEEGSEASAATAVVITGRSlNINRIIFVANRP 362
                       410
                ....*....|....*...
gi 4505595  394 FLFLIMHKITNCILFFGR 411
Cdd:cd02045 363 FLLFIREVAINAIIFMGR 380
bacterial_SERPIN cd02049
SERine Proteinase INhibitors (serpins), prokaryotic subgroup. Little information about ...
7-410 1.34e-83

SERine Proteinase INhibitors (serpins), prokaryotic subgroup. Little information about specific functions is available for this subgroup, most likely they are inhibitory members of the serpin superfamily. In general, serpins exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors.


Pssm-ID: 239004  Cd Length: 364  Bit Score: 259.99  E-value: 1.34e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    7 ANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQfnevganavtpmtpenftscgfmqqiq 86
Cdd:cd02049   4 ANTRFGFKLFSELNKEDVEKNIFISPLSIALALSMTYNGADGTTRKEMLKALG--------------------------- 56
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   87 kgsypdaiLQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAeeAR 166
Cdd:cd02049  57 --------LDNIDLEDLNSALATLMDQLNTHDKTVELIIANSIWIEPGFTLKPDFLQTIKDYYQAYVLELDFQSPA--AA 126
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  167 KKINSWVKTQTKGKIPNLLPegSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREklNIGYI 246
Cdd:cd02049 127 EEINRWVKEKTKGKIDKIVD--KIDPDDVMFLINAVYFKGDWQEPFDKQSTYEAPFYLPDGSTKEVPFMSRTG--NFRYL 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  247 EDLKAQILELPYAGD-VSMFLLLPDEIADVSTGLEllesEITYDKLNKWTSKDKMAedEVEVYIPQFKLEEHYELRSILR 325
Cdd:cd02049 203 ETPGFQAVRLPYGDGrLSMYVFLPKENVSLREFVK----TLTAEKWRKWIEQFRMR--EGSLSLPRFQLEYEIELRDALK 276
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  326 SMGMEDAFNKGRANFSGMSERNdLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGP--QFVADHPFLFLIMHKIT 403
Cdd:cd02049 277 ALGMEEAFTPDAADFSKLGEGN-LYISKVIHKTFIEVNEEGTEAAAATSVEITETSAPAGEpfTMVADRPFLFAIRDNRT 355

                ....*..
gi 4505595  404 NCILFFG 410
Cdd:cd02049 356 GSILFMG 362
neuroserpin cd02048
Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that ...
11-415 3.91e-79

Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA). It is located in neurons in regions of the brain where tPA is also found, suggesting that neuroserpin is the selective inhibitor of tPA in the central nervous system (CNS). This subgroup corresponds to clade I of the serpin superfamily.


Pssm-ID: 239003  Cd Length: 388  Bit Score: 249.37  E-value: 3.91e-79
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   11 FALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANavtpmtpENFtscgfmqqiqkgsy 90
Cdd:cd02048   7 LSVDLYNALRASKEDENIIFSPLSTALALGMVELGAKGSALKEIRHSLGYDGLKNG-------EEF-------------- 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   91 pdailqaqaadkihSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEArKKIN 170
Cdd:cd02048  66 --------------SFLKDLSSMITAKEKEYVFNLANSLYLQNGFHVKEKFLQSNKKYFNAAVKLVDFSQVKAVA-EHIN 130
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  171 SWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLK 250
Cdd:cd02048 131 KWVENHTNNKIKDMFSSRDFTPLTRLVLVNALYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGS 210
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  251 A------QILELPYAGDV-SMFLLLPDEiaDVStgLELLESEITYDKLNKWTSKdkMAEDEVEVYIPQFKLEEHYELRSI 323
Cdd:cd02048 211 NeaggiyQVLELPYEGDEiSLMIILSRQ--EVP--LATLEPLVKAPLIEEWANS--VKKQKVEVYLPRFKVEQKIDLKDV 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  324 LRSMGMEDAFNKGrANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKIT 403
Cdd:cd02048 285 LKNLGITEIFSGG-ADLSGISDSKELYVSKVFHKVFLEVNEEGSEAAASSGMIAISRMAVLYPQVIVDHPFFFLIRNRRT 363
                       410
                ....*....|..
gi 4505595  404 NCILFFGRFSSP 415
Cdd:cd02048 364 GSILFMGRVMHP 375
plant_SERPIN cd02043
SERine Proteinase INhibitors (serpins), plant specific subgroup. It has been suggested that ...
9-415 2.79e-68

SERine Proteinase INhibitors (serpins), plant specific subgroup. It has been suggested that plant serpins play a role in defense against insect predators. This subgroup corresponds to clade P of the serpin superfamily. In general, serpins exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones.


Pssm-ID: 238998  Cd Length: 381  Bit Score: 220.76  E-value: 2.79e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    9 TLFALNLFKHLAKASPTQ-NLFLSPWSISSTMAMVYMGSRGSTEDQMAkvlqfnevganavtpmtpenftscgfmqqiqk 87
Cdd:cd02043   4 CLVAMRLSGHVAAAAGKGsNVIFSPLSINVALSLVAAGARGETLDQLL-------------------------------- 51
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   88 gsypdAILQAQAADKIHSSFRSLSSAINA---STGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEE 164
Cdd:cd02043  52 -----SFLGSPSTDELHAVAASIVDLVLAdasASGGPRLSFANGVWVDKSLSLKPSFKDLAANSYKAEARPVDFRTKAEE 126
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  165 ARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIG 244
Cdd:cd02043 127 VRREVNSWVEKATNGLIKDILPPGSVDSSTKLVLANALYFKGAWSSKFDASDTKDRDFHLLDGTSVRVPFMSSEKDQYVA 206
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  245 YIEDLKaqILELPYA--GDV-----SMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMaedeVEVYIPQFKLEEH 317
Cdd:cd02043 207 AFDGFK--VLRLPYKrgGHDdarqfSMYIYLPDKKDGLADLLEKLVSEPGFLDRHIPASEQEV----GAFMIPKFKFSFG 280
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  318 YELRSILRSMGMEDAFNKGRANFSGMS-ERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHG--GPQFVADHPF 394
Cdd:cd02043 281 FEASEVLKKLGLTLPFDPGGALLSMSSpEGENLYVSSVYHKACVEVDEEGTEAAAATAVVMSGTSSPPprPVDFVADHPF 360
                       410       420
                ....*....|....*....|.
gi 4505595  395 LFLIMHKITNCILFFGRFSSP 415
Cdd:cd02043 361 LFLIREDKTGVVLFLGQVMNP 381
PAI-1_nexin-1 cd02051
Plasminogen activator inhibitor-1_like. Plasminogen activator inhibitor-1 (PAI-1) is the ...
11-415 6.09e-67

Plasminogen activator inhibitor-1_like. Plasminogen activator inhibitor-1 (PAI-1) is the primary, fast-acting inhibitor of plasminogen activators. It is often bound to vitronectin, an abundant component of the extracellular matrix in many tissues. Protease nexin-1 is a potent serpin able to inhibit thrombin, plasmin, and plasminogen activators. PAI-1 and nexin-1 are members of the serpin superfamily and represent clade E. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones.


Pssm-ID: 239006  Cd Length: 377  Bit Score: 217.41  E-value: 6.09e-67
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   11 FALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGAnavtpmtpenftscgfmqqiqkgsy 90
Cdd:cd02051  14 FGIQVFNQVAQARPQENVVVSPHGIASVLGMLQLGADGKTKKQLQTVMRYKINGV------------------------- 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   91 pdailqAQAADKIHssfRSLSSAINAStgnyLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcAEEARKKIN 170
Cdd:cd02051  69 ------AKALKKLN---KAIVSKKNKD----IVTTANAVFAQSGFKMEVPFVPRNKEVFQCEVKSVDFSD-PETAAFSIN 134
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  171 SWVKTQTKGKIPNLL-PEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYI--- 246
Cdd:cd02051 135 DWVKNETKGMIDNLLsPDLADDALTRLVLVNALYFKGLWKSRFQPESTKKRTFHAGDGKTYQVPMLAQLSVFRSGSAstp 214
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  247 EDLKAQILELPYAGD-VSMFLLLPDEiadVSTGLELLESEITYDKLNKWTSKdkMAEDEVEVYIPQFKLEEHYELRSILR 325
Cdd:cd02051 215 NGLWYNIIELPYHGEsISMLIALPTE---KSTPLSAIIPHISTKTIQSWMGT--MVPKRMQLVLPKFTVEAETDLKEPLK 289
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  326 SMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTghGGPQFVADHPFLFLIMHKITNC 405
Cdd:cd02051 290 ALGITDMFDQSKANFTKISRSESLHVSHALQKAKIEVNEDGTKASAATTAILIARS--SPPWFIVDRPFLFFIRHNPTGT 367
                       410
                ....*....|
gi 4505595  406 ILFFGRFSSP 415
Cdd:cd02051 368 ILFMGQINKP 377
HCII cd02047
Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade. ...
1-415 2.26e-66

Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade. HCII is allosterically activated by binding to cell surface glycosaminoglycans (GAGs). The specificity of HCII for thrombin is conferred by a highly acidic hirudin-like N-terminal tail, which becomes available after GAG binding for interaction with the anion-binding exosite I of thrombin. This subgroup corresponds to clade D of the serpin superfamily.


Pssm-ID: 239002  Cd Length: 436  Bit Score: 217.78  E-value: 2.26e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    1 MEDLCVANTLFALNLFKHLA-KASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVgANAVTPMtpENFTsc 79
Cdd:cd02047  62 IQRLNILNANFGFNLYRVLKdQVNTSDNILLAPVGISTAMGMISLGLKGQTQEQVLSTLGFKDF-VNASSKY--EITT-- 136
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   80 gfmqqiqkgsypdailqaqaadkIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFL 159
Cdd:cd02047 137 -----------------------VHNLFRKLTHRLFRRNFGYTLRSVNDLYIKKDFPILLDFKNNVKTYYFAEAQIADFS 193
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  160 ECAeeARKKINSWVKTQTKGKIPNLLPegSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLRE 239
Cdd:cd02047 194 DPA--FITKTNNRIQKLTKGLIKEALE--NVDPATLMMILNCIYFKGTWENKFPVEMTHNRNFRLNEKEVVKVPMMQTKG 269
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  240 KLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIadvsTGLELLESEITYDKLNKWTSkdKMAEDEVEVYIPQFKLEEHYE 319
Cdd:cd02047 270 NFLAAADPELDCDILQLPYVGNISMLIVVPHKL----SGMKTLEKQITPQVVERWQK--SMTNRTREVVLPKFKLEKNYN 343
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  320 LRSILRSMGMEDAFNKGrANFSGMSERnDLFLSEVFHQAMVDVNEEGTEAAAGTG-GVMTGRTghgGPQFVADHPFLFLI 398
Cdd:cd02047 344 LIESLKLMGITDLFTEK-GNMAGVSDE-KIAIDLFKHQGTITVNEEGTEAAAVTTvGFMPLST---QVRFIVDRPFLFLI 418
                       410
                ....*....|....*..
gi 4505595  399 MHKITNCILFFGRFSSP 415
Cdd:cd02047 419 YEHRTNCLLFMGRVANP 435
PZI cd02055
Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of ...
11-411 1.01e-53

Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10). ZPI inhibits coagulation factor Xa , dependent on protein Z (PZ), a vitamin K-dependent plasma protein. ZPI also inhibits factor XIa in a process that does not require PZ. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms.


Pssm-ID: 239010  Cd Length: 365  Bit Score: 182.43  E-value: 1.01e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   11 FALNLFKHLAkASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNevganAVTPMTPenftscgfmqqiqkGSY 90
Cdd:cd02055   9 FGFNLLRKIA-MKHDGNIIFSPFGMSLAMAGLLLAAEGETERQIAKALHLH-----ALKDRDP--------------GLL 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   91 PdailqaqaadkihSSFRSLSSaiNASTGNYLLESVNKL-FGEKSASFREEYIRLCQKYYSSEPQAVDFlECAEEARKKI 169
Cdd:cd02055  69 P-------------ALFKGLKD--NISRNEELGFTQGIFaFIHKDFDVKEAFFNLSKQYFDMECLCMDF-QNASQAKFLI 132
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  170 NSWVKTQTKGKIPNLLPEgsVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDL 249
Cdd:cd02055 133 NHNIKKETKGKIPELFDE--IDPESKLILLDYIFFKGKWLTPFDPEFTEIDTFHIDKYKSIKVPMMFGADKFASTFDENF 210
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  250 KAQILELPYAGDVSMFLLLPDEIADVSTglelLESEITYDKLNKWTSkdKMAEDEVEVYIPQFKLEEHYELRSILRSMGM 329
Cdd:cd02055 211 RCHVIKLPYKGKATMLIVIMEKGEDHLA----LEDHLTMDLVESWLA--NMKSRNMDIFFPKFKLDQKYEMHELLRALGI 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  330 EDAFnkgrANFSGMSE----RNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTghGGPQFVADHPFLFLIMHKITNC 405
Cdd:cd02055 285 KNIF----APFADLSElladGKHLQVSQVLQKAVIEVDEKGTEAAAAIGSEIIAFS--MPPVIKVDRPFHFMIFEETFGM 358

                ....*.
gi 4505595  406 ILFFGR 411
Cdd:cd02055 359 LLFIGR 364
hsp47 cd02046
Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, ...
8-412 7.17e-51

Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen. It has been shown to be essential for collagen biosynthesis, but its exact function is still unclear. Hsp47 is a non-inhibitory member of the SERPIN superfamily and corresponds to clade H.


Pssm-ID: 239001  Cd Length: 366  Bit Score: 175.13  E-value: 7.17e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    8 NTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVganavtpmtpenftscgfmqqiqk 87
Cdd:cd02046   7 SAGLAFNLYHAMAKDKGVENILLSPVVVASSLGLVSMGGKASTASQAKAVLSADKL------------------------ 62
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   88 gsypdailqaqAADKIHSSFRSLSSAI-NASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcAEEAR 166
Cdd:cd02046  63 -----------KDEHVHTGLSELLNEVsNSTARNVTWKIGNRLYGPSSVSFADDFVKNSKKHYNYEHSKINFRD-KRSAL 130
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  167 KKINSWVKTQTKGKIPNLLPEgsVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYI 246
Cdd:cd02046 131 NSINEWAAQTTDGKLPEVTKD--VEKTDGALIVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVSVPMMHRTGLYGYYDD 208
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  247 EDLKAQILELPYAGDVS-MFLLLPDEIADvstgLELLESEITYDKLNKWTSKdkMAEDEVEVYIPQFKLEEHYELRSILR 325
Cdd:cd02046 209 EENKLQIVEMPLAHKLSsMIFIMPYHVEP----LERLEKLLTREQLKTWISK--MKKRAVAISLPKVSLEVSHDLQKHLG 282
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  326 SMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGtggvMTGRTGHGGPQ-FVADHPFLFLIMHKITN 404
Cdd:cd02046 283 DLGLTEAIDKSKADLSKISGKKDLYLSNVFHAAALEWDTEGNPFDPD----IYGREEMRNPKlFYADHPFIFLVKDNKTN 358

                ....*...
gi 4505595  405 CILFFGRF 412
Cdd:cd02046 359 SILFIGRL 366
C1_inh cd02050
C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family. It plays a pivotal role in ...
11-411 4.14e-47

C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family. It plays a pivotal role in regulating the activation of the classical complement pathway and of the contact system, via regulating bradykinin formation, inhibiting factor XII and kallikrein of the contact system, and via acting on factor XI in the coagulation cascade. This subgroup corresponds to clade G of the serpin superfamily.


Pssm-ID: 239005  Cd Length: 352  Bit Score: 164.61  E-value: 4.14e-47
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   11 FALNLFKHLAK-ASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFnevganavtpmtPENFTsCgfmqqiqkgs 89
Cdd:cd02050   5 FSLKLYQHLSEsAKPDTNLLFSPVSIALLLSHLLLGARGKTQRRLESILSY------------PHDFA-C---------- 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   90 ypdailqaqaadkIHSSFRSLSSAINastgnylLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLEcaEEARKKI 169
Cdd:cd02050  62 -------------VHSALKKLKNKLG-------LLSASQIFHHPDLHLRESFTNESWQFYKARPRELSNNS--ELNLEMI 119
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  170 NSWVKTQTKGKIPNLLpeGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSaQRTPVQMMYLRE-KLNIGYIED 248
Cdd:cd02050 120 NSWVAKATNNKIPRLL--DSLPSETRLVLLNAVYFQAQWKKKFDTKHTVLLPFKRNG-DPVKVPVMYSKKyPVASFTDPR 196
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  249 LKAQILELPYAGDVSMFLLLPdeiADVSTGLELLESEITYDKLNKWTSKDKMAEDE-VEVYIPQFKLEEHYELRSILRSM 327
Cdd:cd02050 197 LKAQVGRLELSGGLSLVVLVP---RGPKEDLEAVERALTPPAFLAMLEKMAANTPQrTEVTLPRIKLDLAVDMVALMHKL 273
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  328 GMEDAFNKgrANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTgGVMTGRTghgGPQFVADHPFLFLIMHKITNCIL 407
Cdd:cd02050 274 GLFGLFLD--ANLCGLYQDPELAVDAAQHRAVLTLTEKGVEAAAAT-ATSFART---ALSFEALQPFLFVLWDDQAKVPL 347

                ....
gi 4505595  408 FFGR 411
Cdd:cd02050 348 FMGR 351
PEDF cd02052
Pigment epithelium-derived factor (PEDF)_like. PEDF is non-inhibitory member of the Serpin ...
4-415 5.47e-42

Pigment epithelium-derived factor (PEDF)_like. PEDF is non-inhibitory member of the Serpin superfamily. It exhibits neurotrophic, neuroprotective and antiangiogenic properties and is widely expressed in the developing and adult nervous systems. This subgroup corresponds to clade F1 of the serpin superfamily.


Pssm-ID: 239007  Cd Length: 374  Bit Score: 151.53  E-value: 5.47e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    4 LCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLqfnevganavtpmtpenftscgfmq 83
Cdd:cd02052  15 LAAAVSNFGYDLYRQQASRDPTANVFLSPLSIATALSQLSLGAGERTESQIHRAL------------------------- 69
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   84 qiqkgsYPDAILQAQaadkIHSSFRSLSSAINASTGNylLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAvdfLECAE 163
Cdd:cd02052  70 ------YYDLLNDPE----LHDTYKDLLASLTAPAKG--LKSASRILLERKLRLRLEFVNQVEKSYGERPRI---LAGNA 134
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  164 EARKKINSWVKTQTKGKIPNLLPEgsVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNsaQRTPVQMMYLREK--- 240
Cdd:cd02052 135 LDLQEINDWVQQQTGGKVDRFVKE--IPRNVSILLLGSAYFKGQWITKFDKRNTVLTDFHLD--EQRTVVVPMMSDPnap 210
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  241 LNIGYIEDLKAQILELPYAGDVSMFLLLPDEiadVSTGLELLESEITYDKLNKWTSKDKMAedEVEVYIPQFKLEEHYEL 320
Cdd:cd02052 211 VRYGLDSDLNCKIAQLPLTGGVSIMFFLPDK---VTQNLTLIEESLTSEFVHDIDRELKTV--KAVLTLPKLKLSYETEL 285
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  321 RSILRSMGMEDAFNKgrANFSGMSERnDLFLSEVFHQAMVDVNEEGTEAAAGTgGVMTGRTghGGPQFVADHPFLFLIMH 400
Cdd:cd02052 286 LPSLQELKLQSLFAS--PDFTKITSK-PIKLSHVHHKAVLELNEDGAETAPTP-GSATALT--FPLEYHVDRPFLFVLRD 359
                       410
                ....*....|....*
gi 4505595  401 KITNCILFFGRFSSP 415
Cdd:cd02052 360 EDTGALLFIGKVLDP 374
alpha2AP cd02053
Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests ...
11-410 1.15e-38

Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots. Alpha2-Antiplasmin forms an inactive 1 : 1 stoichiometric complex with plasmin. It also rapidly crosslinks to fibrin during blood clotting by activated coagulation factor XIII, and as a consequence fibrin becomes more resistant to fibrinolysis. Therefore alpha2AP is important in modulating the effectiveness and persistence of fibrin with respect to its susceptibility to digestion and removal by plasmin. This subgroup corresponds to clade F2 of the serpin superfamily.


Pssm-ID: 239008  Cd Length: 351  Bit Score: 142.24  E-value: 1.15e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   11 FALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQfnevganavtpmtpenftscgfmqqiqkgsy 90
Cdd:cd02053   8 FSTDLLSEVAQESTKPNLILSPLSIALALSHLALGAQNETEQRLLKTLH------------------------------- 56
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   91 pdailqaqaADKIHSSFRSLSSaINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPqaVDFLECAEEARKKIN 170
Cdd:cd02053  57 ---------AESLPCLHHLLSR-LRQDLGPGALRLATRMYLQKGFEIKESFLEESEKLYGAKP--VSLTGTKEDDLANIN 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  171 SWVKTQTKGKIPNLLpeGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMY-LREKLNIGYIEDL 249
Cdd:cd02053 125 KWVKEATEGQIPNFL--SDLPHDTVLLLLNAIHFKGFWRNKFDPSLTQRDAFHLDDDFTVSVEMMQaSTYPLRWFHLEQP 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  250 KAQILELPYAGDVSMFLLLPDE-IADVSTGLELLESEITYDKLNKwtskdkmaEDEVEVYIPQFKLEEHYELRSILRSMG 328
Cdd:cd02053 203 EIQVAKFPFKGNMSFVVLMPTPfTWNVSQVLANLNWDDLYRRLPK--------ERPTKVKLPKLKLDYQLELNEALSQLG 274
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  329 MEDAFNKgrANFSGMSERNdLFLSEVFHQAMVDVNEEGTEAAAGTgGVMTGRTghgGPQFVADHPFLFLIMHKITNCILF 408
Cdd:cd02053 275 LQELFQA--PDLSGISDEP-LFVSSVQHQSTLELSEKGVEASAAT-SVATSRS---LSSFSVNRPFLFFIFEDTMGLPLF 347

                ..
gi 4505595  409 FG 410
Cdd:cd02053 348 MG 349
angiotensinogen cd02054
Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role ...
7-415 9.47e-28

Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis. It is also involved in normal and abnormal growth processes. The growth promoting actions of angiotensin have been shown in a variety of cells and tissues. This subgroup represents clade A8 of the serpin superfamily. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones.


Pssm-ID: 239009  Cd Length: 372  Bit Score: 112.62  E-value: 9.47e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595    7 ANTLfALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNevganavtpmTPENFTSCGfmqqiq 86
Cdd:cd02054   6 VNVL-GLRMYGMLSELWVHTNTLLSPTSVFGTLASLYLGASKKTADSLQALLGLP----------WKSKNSDCT------ 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   87 kgSYPDAilqaqaaDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYY-SSEPQAVDFLEcAEEA 165
Cdd:cd02054  69 --SRVDG-------HKVLSTLQAIQSLVDAQGRQLLLSTVVWTFTAPGIHLSQPFVQGLADFSdASFPRSVDFTE-PDVA 138
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  166 RKKINSWVKTQTKGKIPNLLPegSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQM---MYlrekln 242
Cdd:cd02054 139 EEKINNFVQATSDGKVKSSLK--GLSPDSDLLFATSVHFQGNWKTASQLEEPQEFWVDNNTSVSVPMLShtgTF------ 210
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  243 iGYIEDL--KAQILELPYAGDVSMFLLLPDEIADvstgLELLESEITYDKLNKWTskDKMAEDEVEVYIPQFKLEEHYEL 320
Cdd:cd02054 211 -KYLSDIqdNFSITQLPLSKRACLLLVQPHEGSD----LDKVEGKLPQQNSSNWL--KNLSPRTIELTLPKFSLQGSYDL 283
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595  321 RSILRSMGMEDAFNKgRANFSGMSERNdLFLSEVFHQAMVDVNEEGTEAAAGTggvmTGRTGHGGPQFVADHPFLFLIMH 400
Cdd:cd02054 284 QDLLAQMELPALLGS-EANLSKLSNDR-FTVGKVLNKVFFELSEDGTEVQEST----QQLNKPEVLEVTLNRPFLFAVYE 357
                       410
                ....*....|....*
gi 4505595  401 KITNCILFFGRFSSP 415
Cdd:cd02054 358 ANSNAILFLGRVTNP 372
PHA02948 PHA02948
serine protease inhibitor-like protein; Provisional
164-415 7.75e-26

serine protease inhibitor-like protein; Provisional


Pssm-ID: 165258  Cd Length: 373  Bit Score: 107.44  E-value: 7.75e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   164 EARKKINSWVktQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTpVQMMYLREKL-- 241
Cdd:PHA02948 135 DAVNKINSIV--ERRSGMSNVVDSTMLDNNTLWAIINTIYFKGTWQYPFDITKTHNASFTNKYGTKT-VPMMNVVTKLqg 211
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   242 NIGYIEDLKAQILELPYA-GDVSMFLLLPDEIADVStglelleSEITYDKLNKWTSKdkMAEDEVEVYIPQFKLEEHYEL 320
Cdd:PHA02948 212 NTITIDDEEYDMVRLPYKdANISMYLAIGDNMTHFT-------DSITAAKLDYWSSQ--LGNKVYNLKLPRFSIENKRDI 282
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   321 RSILRSMGmEDAFNKGRANFSGMSeRNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFvaDHPFLFLIMH 400
Cdd:PHA02948 283 KSIAEMMA-PSMFNPDNASFKHMT-RDPLYIYKMFQNAKIDVDEQGTVAEASTIMVATARSSPEELEF--NTPFVFIIRH 358
                        250
                 ....*....|....*
gi 4505595   401 KITNCILFFGRFSSP 415
Cdd:PHA02948 359 DITGFILFMGKVESP 373
PHA02660 PHA02660
serpin-like protein; Provisional
157-415 1.82e-18

serpin-like protein; Provisional


Pssm-ID: 165039  Cd Length: 364  Bit Score: 85.85  E-value: 1.82e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   157 DFLECAEEARKKINSWVKTQTKgkIPNLLpegSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMY 236
Cdd:PHA02660 106 DLANHAEPIRRSINEWVYEKTN--IINFL---HYMPDTSILIINAVQFNGLWKYPFLRKKTTMDIFNIDKVSFKYVNMMT 180
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   237 LREKLNIGYIEdlKAQILELPYaGDVS---MFLLLPDEIADvsTGLELLESEITYDKLN--KWTSKDKMaedeVEVYIPQ 311
Cdd:PHA02660 181 TKGIFNAGRYH--QSNIIEIPY-DNCSrshMWIVFPDAISN--DQLNQLENMMHGDTLKafKHASRKKY----LEISIPK 251
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4505595   312 FKLEEHYELRSILRSMGMEDAFNKgrANFSGM----SERNDLFL--SEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGG 385
Cdd:PHA02660 252 FRIEHSFNAEHLLPSAGIKTLFTN--PNLSRMitqgDKEDDLYPlpPSLYQKIILEIDEEGTNTKNIAKKMRRNPQDEDT 329
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 4505595   386 PQFV-------ADHPFLFLIMHKitNCILFFGRFSSP 415
Cdd:PHA02660 330 QQHLfriesiyVNRPFIFIIEYE--NEILFIGRISIP 364
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH