NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|33469958|ref|NP_006834|]
View 

L-serine dehydratase/L-threonine deaminase [Homo sapiens]

Protein Classification

similar to L-serine dehydratase/L-threonine deaminase isoform X1 (domain architecture ID 10157824)

protein similar to L-serine dehydratase/L-threonine deaminase isoform X1

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
10-320 1.05e-154

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


:

Pssm-ID: 107209  Cd Length: 316  Bit Score: 435.96  E-value: 1.05e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  87 VPSTTPALTIERLKNEGATVKVVGELL-DEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWE--KPGAI 163
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLQSqeKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 164 ALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFS 243
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33469958 244 EVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgNLRTPLPSLVVIVCGGSNISLAQLRALKEQL 320
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
10-320 1.05e-154

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 435.96  E-value: 1.05e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  87 VPSTTPALTIERLKNEGATVKVVGELL-DEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWE--KPGAI 163
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLQSqeKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 164 ALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFS 243
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33469958 244 EVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgNLRTPLPSLVVIVCGGSNISLAQLRALKEQL 320
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
PALP pfam00291
Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate ...
5-304 3.37e-56

Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 395228 [Multi-domain]  Cd Length: 295  Bit Score: 184.05  E-value: 3.37e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958     5 EPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRwAKQGCA--HFVCSSAGNAGMAAAYAARQLGVP 82
Cdd:pfam00291   2 SLGIGPTPLVRLPRLSKELGVDVYLKLESLNPTGSFKDRGALNLLLR-LKEGEGgkTVVEASSGNHGRALAAAAARLGLK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    83 ATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGA 162
Cdd:pfam00291  81 CTIVVPEDAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGDPDA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   163 IALSVGGGGLLCGVVQGLQEvGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVK-TVGAQALKLFQEHPI 241
Cdd:pfam00291 161 VVVPVGGGGLIAGIARGLKE-LGPDVRVIGVEPEGAPALARSLAAGRPVPVPVSDTIADGLGVGdEPGALALDLLDEYVG 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 33469958   242 FSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVysHVIQKLQLEGNLRTplpslVVIVCG 304
Cdd:pfam00291 240 EVVTVSDEEALEAMRLLARREGIVVEPSSAAALAAL--KLALAGELKGGDRV-----VVVLTG 295
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
9-318 7.79e-54

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 179.72  E-value: 7.79e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGC--AHFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:COG1171  24 NPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGAYNKLSSLSEEEEraAGVIAASAGNHAQGVAYAAKRLGIKATIV 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  87 VPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIals 166
Cdd:COG1171 104 MPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILEQLPDLPDAV--- 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 167 vggggllcgvvqgLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVS-LPKITSVAKALGVKTVGA 230
Cdd:COG1171 180 -------------FVPVGGGglisgiatalkalspEIKVIGVEPEGAPSMYASLKAGKIVVvLPDVGTIADGLAVKRPGD 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 231 QALKLFQEHPifSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQklQLEGnlrtplPSLVVIVCGGsNI 308
Cdd:COG1171 247 LTFEILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIE--PLQG------KTVVVILSGG-NI 315
                       330
                ....*....|
gi 33469958 309 SLAQLRALKE 318
Cdd:COG1171 316 DFERLAEVLE 325
PRK08198 PRK08198
threonine dehydratase; Provisional
10-308 6.62e-35

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 131.03  E-value: 6.62e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGhfcKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATI 85
Cdd:PRK08198  22 RTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIA---SLSEEERARGVVAASAGNHAQGVAYAASLLGIKATI 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   86 VVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKEtlwEKPGAIAL 165
Cdd:PRK08198  99 VMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE---DLPDVDTV 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  166 svggggllcgvvqgLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGA 230
Cdd:PRK08198 175 --------------VVPIGGGglisgvatavkalrpEVRVIGVQAEGAPAMPESLAAGRPVELESVDTIADGIAVKRPGD 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  231 QALKLFQEHpiFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPSLVVIVCGGsNI 308
Cdd:PRK08198 241 LTFEIIREL--VDDVVtvSDEEIARAILLLLERAKLVVEGAGAVSVAAL---------LSGKLDVKGKKVVAVLSGG-NI 308
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
10-320 1.05e-154

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 435.96  E-value: 1.05e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  87 VPSTTPALTIERLKNEGATVKVVGELL-DEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWE--KPGAI 163
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLQSqeKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 164 ALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFS 243
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33469958 244 EVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgNLRTPLPSLVVIVCGGSNISLAQLRALKEQL 320
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
PALP pfam00291
Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate ...
5-304 3.37e-56

Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 395228 [Multi-domain]  Cd Length: 295  Bit Score: 184.05  E-value: 3.37e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958     5 EPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRwAKQGCA--HFVCSSAGNAGMAAAYAARQLGVP 82
Cdd:pfam00291   2 SLGIGPTPLVRLPRLSKELGVDVYLKLESLNPTGSFKDRGALNLLLR-LKEGEGgkTVVEASSGNHGRALAAAAARLGLK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    83 ATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGA 162
Cdd:pfam00291  81 CTIVVPEDAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGDPDA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   163 IALSVGGGGLLCGVVQGLQEvGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVK-TVGAQALKLFQEHPI 241
Cdd:pfam00291 161 VVVPVGGGGLIAGIARGLKE-LGPDVRVIGVEPEGAPALARSLAAGRPVPVPVSDTIADGLGVGdEPGALALDLLDEYVG 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 33469958   242 FSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVysHVIQKLQLEGNLRTplpslVVIVCG 304
Cdd:pfam00291 240 EVVTVSDEEALEAMRLLARREGIVVEPSSAAALAAL--KLALAGELKGGDRV-----VVVLTG 295
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
9-318 7.79e-54

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 179.72  E-value: 7.79e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGC--AHFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:COG1171  24 NPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGAYNKLSSLSEEEEraAGVIAASAGNHAQGVAYAAKRLGIKATIV 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  87 VPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIals 166
Cdd:COG1171 104 MPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILEQLPDLPDAV--- 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 167 vggggllcgvvqgLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVS-LPKITSVAKALGVKTVGA 230
Cdd:COG1171 180 -------------FVPVGGGglisgiatalkalspEIKVIGVEPEGAPSMYASLKAGKIVVvLPDVGTIADGLAVKRPGD 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 231 QALKLFQEHPifSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQklQLEGnlrtplPSLVVIVCGGsNI 308
Cdd:COG1171 247 LTFEILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIE--PLQG------KTVVVILSGG-NI 315
                       330
                ....*....|
gi 33469958 309 SLAQLRALKE 318
Cdd:COG1171 316 DFERLAEVLE 325
Thr-dehyd cd01562
Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. ...
9-308 4.44e-48

Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly converted into NH4+. The direct deamination is catalyzed by threonine dehydratase, in which pyridoxal phosphate (PLP) is the prosthetic group. Threonine dehydratase is widely distributed in all three major phylogenetic divisions.


Pssm-ID: 107205  Cd Length: 304  Bit Score: 163.43  E-value: 4.44e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGcahFVCSSAGNAGMAAAYAARQLGVPAT 84
Cdd:cd01562  16 RRTPLLTSPTLSELLGAEVYLKCENLQKTGSFKIRGaynkLLSLSEEERAKG---VVAASAGNHAQGVAYAAKLLGIPAT 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  85 IVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEkPGAIa 164
Cdd:cd01562  93 IVMPETAPAAKVDATRAYGAEVVLYGEDFDEAEAKARELAEEE-GLTFIHPFDDPDVIAGQGTIGLEILEQVPD-LDAV- 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 165 lsvggggllcgvvqgLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVG 229
Cdd:cd01562 170 ---------------FVPVGGGgliagiatavkalspNTKVIGVEPEGAPAMAQSLAAGKPVTLPEVDTIADGLAVKRPG 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 230 AQALKLFQEHPifSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHviqKLQLEGNlrtplpSLVVIVCGGsN 307
Cdd:cd01562 235 ELTFEIIRKLV--DDVVtvSEDEIAAAMLLLFEREKLVAEPAGALALAALLSG---KLDLKGK------KVVVVLSGG-N 302

                .
gi 33469958 308 I 308
Cdd:cd01562 303 I 303
Trp-synth-beta_II cd00640
Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP) ...
11-305 1.53e-46

Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehyd catalyzes the conversion of L- or D-serine to pyruvate and ammonia. Thr-dehyd is active as a homodimer and catalyzes the conversion of L-threonine to 2-oxobutanoate and ammonia. DAL is also a homodimer and catalyzes the alpha, beta-elimination reaction of both L- and D-alpha, beta-diaminopropionate to form pyruvate and ammonia. Thr-synth catalyzes the formation of threonine and inorganic phosphate from O-phosphohomoserine.


Pssm-ID: 107202 [Multi-domain]  Cd Length: 244  Bit Score: 157.68  E-value: 1.53e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  11 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIVV 87
Cdd:cd00640   1 TPLVRLKRLSKLGGANIYLKLEFLNPTGSFKDRGALNLILLAEEEGklpKGVIIESTGGNTGIALAAAAARLGLKCTIVM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  88 PSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAIals 166
Cdd:cd00640  81 PEGASPEKVAQMRALGAEVVLVPGDFDDAIALAKELAEEDPGAYYVNQFDNPANIAGQGTIGLEILEQLgGQKPDAV--- 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 167 vggggllcgvvqglqevgwgdvpVIAMETFGAhsfhaattagklvslpkITSVAKAL-----GVKTVGAQAlklfqehpi 241
Cdd:cd00640 158 -----------------------VVPVGGGGN-----------------IAGIARALkellpNVKVIGVEP--------- 188
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33469958 242 FSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgnlrtplpSLVVIVCGG 305
Cdd:cd00640 189 EVVTVSDEEALEAIRLLAREEGILVEPSSAAALAAALKLAKKLGKGK--------TVVVILTGG 244
PRK08198 PRK08198
threonine dehydratase; Provisional
10-308 6.62e-35

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 131.03  E-value: 6.62e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGhfcKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATI 85
Cdd:PRK08198  22 RTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIA---SLSEEERARGVVAASAGNHAQGVAYAASLLGIKATI 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   86 VVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKEtlwEKPGAIAL 165
Cdd:PRK08198  99 VMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE---DLPDVDTV 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  166 svggggllcgvvqgLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGA 230
Cdd:PRK08198 175 --------------VVPIGGGglisgvatavkalrpEVRVIGVQAEGAPAMPESLAAGRPVELESVDTIADGIAVKRPGD 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  231 QALKLFQEHpiFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPSLVVIVCGGsNI 308
Cdd:PRK08198 241 LTFEIIREL--VDDVVtvSDEEIARAILLLLERAKLVVEGAGAVSVAAL---------LSGKLDVKGKKVVAVLSGG-NI 308
PRK12483 PRK12483
threonine dehydratase; Reviewed
9-319 2.36e-28

threonine dehydratase; Reviewed


Pssm-ID: 237111 [Multi-domain]  Cd Length: 521  Bit Score: 114.51  E-value: 2.36e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFV-CSSAGNAGMAAAYAARQLGVPATIVV 87
Cdd:PRK12483  36 RETPLQRAPNLSARLGNQVLLKREDLQPVFSFKIRGAYNKMARLPAEQLARGViTASAGNHAQGVALAAARLGVKAVIVM 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   88 PSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELketLWEKPGAIALSv 167
Cdd:PRK12483 116 PRTTPQLKVDGVRAHGGEVVLHGESFPDALAHALKLAEEE-GLTFVPPFDDPDVIAGQGTVAMEI---LRQHPGPLDAI- 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  168 ggggllcgvvqgLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQA 232
Cdd:PRK12483 191 ------------FVPVGGGgliagiaayvkyvrpEIKVIGVEPDDSNCLQAALAAGERVVLGQVGLFADGVAVAQIGEHT 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  233 LKLFQEHpiFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKlQLEGnlRTplpslVVIVCGGSNISL 310
Cdd:PRK12483 259 FELCRHY--VDEVVtvSTDELCAAIKDIYDDTRSITEPAGALAVAGIKKYAERE-GIEG--QT-----LVAIDSGANVNF 328

                 ....*....
gi 33469958  311 AQLRALKEQ 319
Cdd:PRK12483 329 DRLRHVAER 337
PRK08639 PRK08639
threonine dehydratase; Validated
9-307 5.39e-26

threonine dehydratase; Validated


Pssm-ID: 236318 [Multi-domain]  Cd Length: 420  Bit Score: 106.81  E-value: 5.39e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHF-CKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVV 87
Cdd:PRK08639  24 PETPLQRNDYLSEKYGANVYLKREDLQPVRSYKLRGAYNAiSQLSDEELAAGVVCASAGNHAQGVAYACRHLGIPGVIFM 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   88 PSTTPALTIERLK---NEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP---- 160
Cdd:PRK08639 104 PVTTPQQKIDQVRffgGEFVEIVLVGDTFDDSAAAAQEYAEET-GATFIPPFDDPDVIAGQGTVAVEILEQLEKEGspdy 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  161 --------GAIALSVGGggllcgvvqgLQEVGWgDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQA 232
Cdd:PRK08639 183 vfvpvgggGLISGVTTY----------LKERSP-KTKIIGVEPAGAASMKAALEAGKPVTLEKIDKFVDGAAVARVGDLT 251
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33469958  233 LKLFQEHPifSEVIS-DQEAV-AAIEKFVDDEKILVEPACGAALAAVYSHviqKLQLEGnlrtplpSLVVIVCGGSN 307
Cdd:PRK08639 252 FEILKDVV--DDVVLvPEGAVcTTILELYNKEGIVAEPAGALSIAALELY---KDEIKG-------KTVVCVISGGN 316
PRK09224 PRK09224
threonine ammonia-lyase IlvA;
9-314 1.71e-25

threonine ammonia-lyase IlvA;


Pssm-ID: 236417 [Multi-domain]  Cd Length: 504  Bit Score: 106.38  E-value: 1.71e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPAT 84
Cdd:PRK09224  19 QETPLEKAPKLSARLGNQVLLKREDLQPVFSFKLRGaynkMAQLTEEQLARGV---ITASAGNHAQGVALSAARLGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   85 IVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIA 164
Cdd:PRK09224  96 IVMPVTTPDIKVDAVRAFGGEVVLHGDSFDEAYAHAIELAEEE-GLTFIHPFDDPDVIAGQGTIAMEILQQHPHPLDAVF 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  165 LSvggggllcgvvqglqeVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVG 229
Cdd:PRK09224 175 VP----------------VGGGgliagvaayikqlrpEIKVIGVEPEDSACLKAALEAGERVDLPQVGLFADGVAVKRIG 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  230 AQALKLFQEHpiFSEVI---SDqEAVAAIEKFVDDEKILVEPAcGA-ALAAVYSHViQKLQLEGNlrtplpSLVVIVCgG 305
Cdd:PRK09224 239 EETFRLCQEY--VDDVItvdTD-EICAAIKDVFEDTRSIAEPA-GAlALAGLKKYV-AQHGIEGE------TLVAILS-G 306

                 ....*....
gi 33469958  306 SNISLAQLR 314
Cdd:PRK09224 307 ANMNFDRLR 315
PRK08246 PRK08246
serine/threonine dehydratase;
27-305 5.00e-24

serine/threonine dehydratase;


Pssm-ID: 181319  Cd Length: 310  Bit Score: 99.64  E-value: 5.00e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   27 VYLKMDSAQPSGSFKIRGIGHFCkRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATV 106
Cdd:PRK08246  39 VWLKLEHLQHTGSFKARGAFNRL-LAAPVPAAGVVAASGGNAGLAVAYAAAALGVPATVFVPETAPPAKVARLRALGAEV 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  107 KVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP---------GAIAlsvggggllcgvv 177
Cdd:PRK08246 118 VVVGAEYADALEAAQAFAAET-GALLCHAYDQPEVLAGAGTLGLEIEEQAPGVDtvlvavgggGLIA------------- 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  178 qGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEK 257
Cdd:PRK08246 184 -GIAAWFEGRARVVAVEPEGAPTLHAALAAGEPVDVPVSGIAADSLGARRVGEIAFALARAHVVTSVLVSDEAIIAARRA 262
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 33469958  258 FVDDEKILVEPACGAALAAVYShviqklqleGNLRtPLPS--LVVIVCGG 305
Cdd:PRK08246 263 LWEELRLAVEPGAATALAALLS---------GAYV-PAPGerVAVVLCGA 302
PLN02550 PLN02550
threonine dehydratase
9-318 1.60e-23

threonine dehydratase


Pssm-ID: 178165 [Multi-domain]  Cd Length: 591  Bit Score: 100.77  E-value: 1.60e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFV-CSSAGNAGMAAAYAARQLGVPATIVV 87
Cdd:PLN02550 108 IESPLQLAKKLSERLGVKVLLKREDLQPVFSFKLRGAYNMMAKLPKEQLDKGViCSSAGNHAQGVALSAQRLGCDAVIAM 187
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   88 PSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSV 167
Cdd:PLN02550 188 PVTTPEIKWQSVERLGATVVLVGDSYDEAQAYAKQRALEE-GRTFIPPFDHPDVIAGQGTVGMEIVRQHQGPLHAIFVPV 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  168 GGGGLLCGVVQGLQEVGwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVIS 247
Cdd:PLN02550 267 GGGGLIAGIAAYVKRVR-PEVKIIGVEPSDANAMALSLHHGERVMLDQVGGFADGVAVKEVGEETFRLCRELVDGVVLVS 345
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 33469958  248 DQEAVAAIEKFVDDEKILVEPACGAALAAVYSHViQKLQLEGnlrtplpSLVVIVCGGSNISLAQLRALKE 318
Cdd:PLN02550 346 RDAICASIKDMFEEKRSILEPAGALALAGAEAYC-KYYGLKD-------ENVVAITSGANMNFDRLRIVTE 408
eutB PRK07476
threonine dehydratase; Provisional
9-316 7.72e-23

threonine dehydratase; Provisional


Pssm-ID: 236025  Cd Length: 322  Bit Score: 96.57  E-value: 7.72e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH-FVCSSAGNAGMAAAYAARQLGVPATIVV 87
Cdd:PRK07476  18 RRTPLVASASLSARAGVPVWLKLETLQPTGSFKLRGATNALLSLSAQERARgVVTASTGNHGRALAYAARALGIRATICM 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   88 PSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP------- 160
Cdd:PRK07476  98 SRLVPANKVDAIRALGAEVRIVGRSQDDAQAEVERLVREE-GLTMVPPFDDPRIIAGQGTIGLEILEALPDVAtvlvpls 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  161 --GAIALSVGGGGLLCGVVQglqevgwgdVPVIAMETfGAhSFHAATTAGKLVSLPKITSVAKALGvktvGAQAL----- 233
Cdd:PRK07476 177 ggGLASGVAAAVKAIRPAIR---------VIGVSMER-GA-AMHASLAAGRPVQVEEVPTLADSLG----GGIGLdnryt 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  234 -KLFQEhpIFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPSLVVIVCGGsNISL 310
Cdd:PRK07476 242 fAMCRA--LLDDVVllDEAEIAAGIRHAYREERLVVEGAGAVGIAAL---------LAGKIAARDGPIVVVVSGA-NIDM 309

                 ....*.
gi 33469958  311 AQLRAL 316
Cdd:PRK07476 310 ELHRRI 315
PRK08526 PRK08526
threonine dehydratase; Provisional
9-319 2.75e-22

threonine dehydratase; Provisional


Pssm-ID: 181457 [Multi-domain]  Cd Length: 403  Bit Score: 96.32  E-value: 2.75e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPAT 84
Cdd:PRK08526  19 NKTPFAYAPFLSKISGAEVYLKKENLQITGAYKIRGaynkIANLSEEQKQHGV---IAASAGNHAQGVAISAKKFGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   85 IVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLwEKPGAIA 164
Cdd:PRK08526  96 IVMPEATPLLKVSGTKALGAEVILKGDNYDEAYAFALEYAKEN-NLTFIHPFEDEEVMAGQGTIALEMLDEI-SDLDMVV 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  165 LSVGGGGLLCGVVQGLQEVGwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEhpIFSE 244
Cdd:PRK08526 174 VPVGGGGLISGIASAAKQIN-PNIKIIGVGAKGAPAMYESFHAKKIINSKSVRTIADGIAVRDASPINLAIILE--CVDD 250
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33469958  245 VIS--DQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQ 319
Cdd:PRK08526 251 FVQvdDEEIANAILFLLEKQKIVVEGAGAASVAAL---------LHQKIDLKKGKKIGVVLSGGNIDVQMLNIIIEK 318
PRK06815 PRK06815
threonine/serine dehydratase;
11-315 2.55e-21

threonine/serine dehydratase;


Pssm-ID: 180709  Cd Length: 317  Bit Score: 92.45  E-value: 2.55e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   11 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGcahFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:PRK06815  21 TPLEHSPLLSQHTGCEVYLKCEHLQHTGSFKFRGasnkLRLLNEAQRQQG---VITASSGNHGQGVALAAKLAGIPVTVY 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   87 VPSTTPALTIERLKNEGATVKVVGELLDEAfELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLwEKPGAIALS 166
Cdd:PRK06815  98 APEQASAIKLDAIRALGAEVRLYGGDALNA-ELAARRAAEQQGKVYISPYNDPQVIAGQGTIGMELVEQQ-PDLDAVFVA 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  167 VGGGGLLCGVVQGLQEVGwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAK--ALGVKTvGAQALKLFQEHPIFSE 244
Cdd:PRK06815 176 VGGGGLISGIATYLKTLS-PKTEIIGCWPANSPSLYTSLEAGEIVEVAEQPTLSDgtAGGVEP-GAITFPLCQQLIDQKV 253
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 33469958  245 VISDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqkLQLEGNLRTplPSLVVIVCgGSNISLAQLRA 315
Cdd:PRK06815 254 LVSEEEIKEAMRLIAETDRWLIEGAAGVALAAA-------LKLAPRYQG--KKVAVVLC-GKNIVLEKYLE 314
PLN02970 PLN02970
serine racemase
10-313 1.41e-19

serine racemase


Pssm-ID: 215524  Cd Length: 328  Bit Score: 87.43  E-value: 1.41e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPATI 85
Cdd:PLN02970  27 RTPVLTSSSLDALAGRSLFFKCECFQKGGAFKFRGacnaIFSLSDDQAEKGV---VTHSSGNHAAALALAAKLRGIPAYI 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   86 VVPSTTPALTIERLKNEGATVkVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETL--------- 156
Cdd:PLN02970 104 VVPKNAPACKVDAVIRYGGII-TWCEPTVESREAVAARVQQETGAVLIHPYNDGRVISGQGTIALEFLEQVpeldviivp 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  157 WEKPGAIAlsvggggLLCGVVQGLQEvgwgDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKtVGAQALKLF 236
Cdd:PLN02970 183 ISGGGLIS-------GIALAAKAIKP----SIKIIAAEPKGADDAAQSKAAGEIITLPVTNTIADGLRAS-LGDLTWPVV 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  237 QEhpIFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQ-KLQLEGNLRtplpsLVVIVCGGsNISLAQL 313
Cdd:PLN02970 251 RD--LVDDVItvDDKEIIEAMKLCYERLKVVVEPSGAIGLAAALSDSFRsNPAWKGCKN-----VGIVLSGG-NVDLGVL 322
PRK07334 PRK07334
threonine dehydratase; Provisional
9-280 3.42e-19

threonine dehydratase; Provisional


Pssm-ID: 235994 [Multi-domain]  Cd Length: 403  Bit Score: 87.26  E-value: 3.42e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958    9 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIghfCKRWAK-------------------QGCAHfvcssagnag 69
Cdd:PRK07334  22 LRTPCVHSRTLSQITGAEVWLKFENLQFTASFKERGA---LNKLLLlteeerargviamsagnhaQGVAY---------- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   70 maaayAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIV 149
Cdd:PRK07334  89 -----HAQRLGIPATIVMPRFTPTVKVERTRGFGAEVVLHGETLDEARAHARELAEEE-GLTFVHPYDDPAVIAGQGTVA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  150 KELketLWEKP------------GAIAlsvggggllcgvvqGLQEVGWG---DVPVIAMETfgaHSFHAATTAGKLVSLP 214
Cdd:PRK07334 163 LEM---LEDAPdldtlvvpigggGLIS--------------GMATAAKAlkpDIEIIGVQT---ELYPSMYAAIKGVALP 222
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 33469958  215 KITS-VAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH 280
Cdd:PRK07334 223 CGGStIAEGIAVKQPGQLTLEIVRRLVDDILLVSEADIEQAVSLLLEIEKTVVEGAGAAGLAALLAY 289
PRK08638 PRK08638
bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;
10-320 1.39e-18

bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;


Pssm-ID: 236317  Cd Length: 333  Bit Score: 84.79  E-value: 1.39e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGcahFVCSSAGNAGMAAAYAARQLGVPATI 85
Cdd:PRK08638  27 KTPLPRSNYLSERCKGEIFLKLENMQRTGSFKIRGafnkLSSLTDAEKRKG---VVACSAGNHAQGVALSCALLGIDGKV 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   86 VVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIAl 165
Cdd:PRK08638 104 VMPKGAPKSKVAATCGYGAEVVLHGDNFNDTIAKVEEIVEEE-GRTFIPPYDDPKVIAGQGTIGLEILEDLWDVDTVIV- 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  166 svggggllcgvvqglqEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGA 230
Cdd:PRK08638 182 ----------------PIGGGgliagiavalksinpTIHIIGVQSENVHGMAASFYAGEITTHRTTGTLADGCDVSRPGN 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  231 QALKLFQEhpIFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLqLEGNlrtplpSLVVIVCGGsNI 308
Cdd:PRK08638 246 LTYEIVRE--LVDDIVlvSEDEIRNAMKDLIQRNKVVTEGAGALATAALLSGKLDQY-IQNK------KVVAIISGG-NV 315
                        330
                 ....*....|..
gi 33469958  309 SLAQLRALKEQL 320
Cdd:PRK08638 316 DLSRVSQITGHV 327
Thr-synth_1 cd01563
Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last ...
11-304 1.59e-17

Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate. It proceeds by converting O-phospho-L-homoserine (OPH) into threonine and inorganic phosphate. In plants, OPH is an intermediate between the methionine and threonine/isoleucine pathways. Thus threonine synthase competes for OPH with cystathionine-gamma-synthase, the first enzyme in the methionine pathway. These enzymes are in general dimers. Members of this CD, Thr-synth_1, are widely distributed in bacteria, archaea and higher plants.


Pssm-ID: 107206  Cd Length: 324  Bit Score: 81.49  E-value: 1.59e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  11 TPIRDSMALSKMAGT-SVYLKMDSAQPSGSFKIRG----IGHfckrwAKQ-GCAHFVCSSAGNAGMAAAYAARQLGVPAT 84
Cdd:cd01563  23 TPLVRAPRLGERLGGkNLYVKDEGLNPTGSFKDRGmtvaVSK-----AKElGVKAVACASTGNTSASLAAYAARAGIKCV 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  85 IVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpgWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAI 163
Cdd:cd01563  98 VFLPAGKALGKLAQALAYGATVLAVEGNFDDALRLVRELAEEN--WIYLSNSLNPYRLEGQKTIAFEIAEQLgWEVPDYV 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 164 ALSVGGGGLLCGVVQG---LQEVGWGD-VP-VIAMETFGAHSFHAATTAGK--LVSLPKITSVAKAL--GVKTVGAQALK 234
Cdd:cd01563 176 VVPVGNGGNITAIWKGfkeLKELGLIDrLPrMVGVQAEGAAPIVRAFKEGKddIEPVENPETIATAIriGNPASGPKALR 255
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 235 LFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviQKLQLEGNLRTPlPSLVVIVCG 304
Cdd:cd01563 256 AVRESGGTAVAVSDEEILEAQKLLARTEGIFVEPASAASLAGL-----KKLREEGIIDKG-ERVVVVLTG 319
PRK06352 PRK06352
threonine synthase; Validated
11-281 3.37e-16

threonine synthase; Validated


Pssm-ID: 180539  Cd Length: 351  Bit Score: 78.17  E-value: 3.37e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   11 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPST 90
Cdd:PRK06352  29 TPLIPLPNLSKELGVTLYGKYEGLNPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   91 TPAL-TIERLKNEGATVKVVGELLDEAFELAKALAKNNPgwVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGG 169
Cdd:PRK06352 109 KVALgKLAQAVMYGADIISIQGNFDEALKSVRELAETEA--VTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  170 GGLLCGVVQGLQEvgWGDVPVIAMETFgaHSFH----AATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEV 245
Cdd:PRK06352 187 AGNISAYWKGFKE--WNEAKASGLPRM--HGFEaegaAAIVQGKPIDNPETIATAIRIGNPASWGLAEAARDESGGYIHS 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 33469958  246 ISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHV 281
Cdd:PRK06352 263 VTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHV 298
PRK06382 PRK06382
threonine dehydratase; Provisional
10-326 7.85e-15

threonine dehydratase; Provisional


Pssm-ID: 180550 [Multi-domain]  Cd Length: 406  Bit Score: 74.54  E-value: 7.85e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG-IGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVP 88
Cdd:PRK06382  25 RTPLIHSTTFGDEYGGDIYFKLENFQKTGSFKSRGaVFKFSKLSEDELRNGVITASAGNHAQGVAYAASINGIDAKIVMP 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   89 STTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEkpgaialsvg 168
Cdd:PRK06382 105 EYTIPQKVNAVEAYGAHVILTGRDYDEAHRYADKIAMDE-NRTFIEAFNDRWVISGQGTIGLEIMEDLPD---------- 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  169 gggllcgVVQGLQEVGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQAL 233
Cdd:PRK06382 174 -------LDQIIVPVGGGglisgialaakhinpNVKIIGIESELSDSMKASLREGKIVAHTSGVSICDGISVKYPGDLTF 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  234 KLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYshviqklqlEGNLRTPLPSLVVIVCGGSNISLAQL 313
Cdd:PRK06382 247 DIAKNYVDDIVTVTEESVSKAIYKLFEREKIVAEPSGAVGLAAIM---------EGKVDVKGKKVAIVVSGGNINPLLMS 317
                        330
                 ....*....|...
gi 33469958  314 RALKEQLGMTNRL 326
Cdd:PRK06382 318 KIIYKELENLGQL 330
PRK06608 PRK06608
serine/threonine dehydratase;
10-163 3.22e-14

serine/threonine dehydratase;


Pssm-ID: 235842  Cd Length: 338  Bit Score: 72.11  E-value: 3.22e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGC--AHFVCSSAGNAGMAAAYAARQLGVPATIVV 87
Cdd:PRK06608  23 LTPIVHSESLNEMLGHEIFFKVESLQKTGAFKVRGVLNHLLELKEQGKlpDKIVAYSTGNHGQAVAYASKLFGIKTRIYL 102
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 33469958   88 PSTTPALTIERLKNEGATVKVVgELLDEAFElaKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAI 163
Cdd:PRK06608 103 PLNTSKVKQQAALYYGGEVILT-NTRQEAEE--KAKEDEEQGFYYIHPSDSDSTIAGAGTLCYEALQQLGFSPDAI 175
PRK07048 PRK07048
threo-3-hydroxy-L-aspartate ammonia-lyase;
10-154 1.32e-12

threo-3-hydroxy-L-aspartate ammonia-lyase;


Pssm-ID: 235918  Cd Length: 321  Bit Score: 67.35  E-value: 1.32e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCAHFvcsSAGNAGMAAAYAARQLGVPATI 85
Cdd:PRK07048  24 RTPVLTSRTADARTGAQVFFKCENFQRMGAFKFRGaynaLSQFSPEQRRAGVVTF---SSGNHAQAIALSARLLGIPATI 100
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33469958   86 VVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKE 154
Cdd:PRK07048 101 VMPQDAPAAKVAATRGYGGEVVTYDRYTEDREEIGRRLAEER-GLTLIPPYDHPHVIAGQGTAAKELFE 168
PRK08813 PRK08813
threonine dehydratase; Provisional
27-276 2.19e-12

threonine dehydratase; Provisional


Pssm-ID: 236339  Cd Length: 349  Bit Score: 66.96  E-value: 2.19e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   27 VYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH-FVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGAT 105
Cdd:PRK08813  50 VWLKLENLQRTGSYKVRGALNALLAGLERGDERpVICASAGNHAQGVAWSAYRLGVQAITVMPHGAPQTKIAGVAHWGAT 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  106 VKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKEtlwEKPGAIALSVGGGGLLCGVVQGLQEVGw 185
Cdd:PRK08813 130 VRQHGNSYDEAYAFARELADQN-GYRFLSAFDDPDVIAGQGTVGIELAA---HAPDVVIVPIGGGGLASGVALALKSQG- 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  186 gdVPVIAMETFGAHSFhAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKIL 265
Cdd:PRK08813 205 --VRVVGAQVEGVDSM-ARAIRGDLREIAPVATLADGVKVKIPGFLTRRLCSSLLDDVVIVREAELRETLVRLALEEHVI 281
                        250
                 ....*....|.
gi 33469958  266 VEPACGAALAA 276
Cdd:PRK08813 282 AEGAGALALAA 292
PRK06721 PRK06721
threonine synthase; Reviewed
11-281 3.55e-11

threonine synthase; Reviewed


Pssm-ID: 136018  Cd Length: 352  Bit Score: 63.17  E-value: 3.55e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   11 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPST 90
Cdd:PRK06721  29 TPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   91 TPAL-TIERLKNEGATVKVVGELLDEAFELAKALAKNNPgwVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGG 169
Cdd:PRK06721 109 KIAHgKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEP--ITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  170 GGLLCGVVQGL----QEVGWGDVPVIAMETFGAhsfhAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEV 245
Cdd:PRK06721 187 AGNITAYWKGFceyeKEKGYKKPRIHGFEAEGA----AAIVKGHVIDEPETIATAIRIGNPASWSYAVEAAEQSHGEIDM 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 33469958  246 ISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHV 281
Cdd:PRK06721 263 VSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHV 298
PRK05638 PRK05638
threonine synthase; Validated
11-306 4.30e-09

threonine synthase; Validated


Pssm-ID: 235539 [Multi-domain]  Cd Length: 442  Bit Score: 57.13  E-value: 4.30e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   11 TPIRDSMALSKMaGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPST 90
Cdd:PRK05638  67 TPLIRARISEKL-GENVYIKDETRNPTGSFRDRLATVAVSYGLPYAANGFIVASDGNAAASVAAYSARAGKEAFVVVPRK 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   91 TPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLweKPGAIALSVGGG 170
Cdd:PRK05638 146 VDKGKLIQMIAFGAKIIRYGESVDEAIEYAEELARLN-GLYNVTPEYNIIGLEGQKTIAFELWEEI--NPTHVIVPTGSG 222
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  171 GLLCGVVQG---LQEVGWGD-VP-VIAMETfgahsFHAATTAGKLVSLPKITSVAKALGV----KTVGAQALKLFQEHPI 241
Cdd:PRK05638 223 SYLYSIYKGfkeLLEIGVIEeIPkLIAVQT-----ERCNPIASEILGNKTKCNETKALGLyvknPVMKEYVSEAIKESGG 297
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33469958  242 FSEVISDQEAVAAiEKFVDDEKILVEPACGAALAAVyshviqkLQLEGNLRTPLPSLVVIVCGGS 306
Cdd:PRK05638 298 TAVVVNEEEIMAG-EKLLAKEGIFAELSSAVVMPAL-------LKLGEEGYIEKGDKVVLVVTGS 354
PRK08197 PRK08197
threonine synthase; Validated
11-277 1.52e-08

threonine synthase; Validated


Pssm-ID: 181283 [Multi-domain]  Cd Length: 394  Bit Score: 55.39  E-value: 1.52e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   11 TPIRDSMALSKMAG-TSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPS 89
Cdd:PRK08197  80 TPLLPLPRLGKALGiGRLWVKDEGLNPTGSFKARGLAVGVSRAKELGVKHLAMPTNGNAGAAWAAYAARAGIRATIFMPA 159
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   90 TTPALTIERLKNEGATVKVVGELLDEAFELAKAlAKNNPGWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAI---AL 165
Cdd:PRK08197 160 DAPEITRLECALAGAELYLVDGLISDAGKIVAE-AVAEYGWFDVSTLKEPYRIEGKKTMGLELAEQLgWRLPDVIlypTG 238
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  166 SVGGGGLLCGVVQGLQEVGW--GDVP-VIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGV---KTVGAQ-ALKLFQE 238
Cdd:PRK08197 239 GGVGLIGIWKAFDELEALGWigGKRPrLVAVQAEGCAPIVKAWEEGKEESEFWEDAHTVAFGIrvpKALGDFlVLDAVRE 318
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 33469958  239 HPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAV 277
Cdd:PRK08197 319 TGGCAIAVSDDAILAAQRELAREEGLFACPEGAATFAAA 357
PRK06110 PRK06110
threonine dehydratase;
19-314 9.00e-08

threonine dehydratase;


Pssm-ID: 235699  Cd Length: 322  Bit Score: 52.69  E-value: 9.00e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   19 LSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG--CAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTpalTI 96
Cdd:PRK06110  30 LAERLGCEVWVKHENHTPTGAFKVRGGLVYFDRLARRGprVRGVISATRGNHGQSVAFAARRHGLAATIVVPHGN---SV 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   97 ErlKNE-----GATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIwEGHASIVKELKETLwekpgaialsvgggg 171
Cdd:PRK06110 107 E--KNAamralGAELIEHGEDFQAAREEAARLAAER-GLHMVPSFHPDLV-RGVATYALELFRAV--------------- 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  172 llcgvvQGLQEV------GWGDVPVIA--------METFGAHSFHAAT-----TAGKLVSLPKITSVAKALGVKTVGAQA 232
Cdd:PRK06110 168 ------PDLDVVyvpigmGSGICGAIAardalglkTRIVGVVSAHAPAyalsfEAGRVVTTPVATTLADGMACRTPDPEA 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  233 LKLFQEHpiFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYShviQKLQLEGnLRtplpslVVIVCGGSNISL 310
Cdd:PRK06110 242 LEVIRAG--ADRIVrvTDDEVAAAMRAYFTDTHNVAEGAGAAALAAALQ---ERERLAG-KR------VGLVLSGGNIDR 309

                 ....
gi 33469958  311 AQLR 314
Cdd:PRK06110 310 AVFA 313
CBS_like cd01561
CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS ...
10-277 8.31e-07

CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.


Pssm-ID: 107204  Cd Length: 291  Bit Score: 49.82  E-value: 8.31e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  10 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH------------------FVCssagnagma 71
Cdd:cd01561   2 NTPLVRLNRLSPGTGAEIYAKLEFFNPGGSVKDRIALYMIEDAEKRGLLKpgttiieptsgntgiglaMVA--------- 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  72 aayaaRQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDE----AFELAKALAKNNPGWVYIPPFDDPLIWEGH-- 145
Cdd:cd01561  73 -----AAKGYRFIIVMPETMSEEKRKLLRALGAEVILTPEAEADgmkgAIAKARELAAETPNAFWLNQFENPANPEAHye 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 146 ---ASIVKELKETLwekpgaialsvggggllcgvvqglqevgwgDVPVIAMETFGahsfhaaTTAGklvslpkitsVAKA 222
Cdd:cd01561 148 ttaPEIWEQLDGKV------------------------------DAFVAGVGTGG-------TITG----------VARY 180
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 223 L-----GVKTVGAQALK--LFQEHPIFS---------------------EV--ISDQEAVAAIEKFVDDEKILVEPACGA 272
Cdd:cd01561 181 LkeknpNVRIVGVDPVGsvLFSGGPPGPhkiegigagfipenldrslidEVvrVSDEEAFAMARRLAREEGLLVGGSSGA 260

                ....*
gi 33469958 273 ALAAV 277
Cdd:cd01561 261 AVAAA 265
ThrC COG0498
Threonine synthase [Amino acid transport and metabolism];
11-276 1.02e-06

Threonine synthase [Amino acid transport and metabolism];


Pssm-ID: 223572 [Multi-domain]  Cd Length: 411  Bit Score: 50.01  E-value: 1.02e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  11 TPIRDSMALSKMAGTS---VYLKMDSAQPSGSFKIRGiGHFCKRWAKQ-GCAHFVCSSAGNAGMAAAYAARQLGVPATIV 86
Cdd:COG0498  77 TPLYKAPALAAPLGVLndnLYVKELGHNPTGSFKDRG-MTVLVSLAKElGAKTILCASSGNTGASAAAYAARAGLKVFVL 155
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  87 VPST-TPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAIA 164
Cdd:COG0498 156 YPKGkVSPGKLAQMLTLGAHVIAVDGNFDDAQELVKEAANRE-GLLSAVNSINPYRLEGQKTYAFEIAEQLgWKAPDHVV 234
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 165 LSVGGGGLLCGVVQGLQE---VGWGDV-P-VIAMETFGAHSFHAATTAGKlvSLPKITSVAKALGVKTVGAQALKLFQEH 239
Cdd:COG0498 235 VPVGNGGNLLAIYKGFKEglpIGKIDKaPnMNGVQAEGFSPGVYAWKEGR--ETPETIAPAMDIGNPSNWERALFALRES 312
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 33469958 240 PIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAA 276
Cdd:COG0498 313 GGLAVAVSDEEILEAIKLLAEREGILIEPHSAVAVAA 349
CysK COG0031
Cysteine synthase [Amino acid transport and metabolism];
77-303 1.22e-05

Cysteine synthase [Amino acid transport and metabolism];


Pssm-ID: 223110  Cd Length: 300  Bit Score: 45.99  E-value: 1.22e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  77 RQLGVPATIVVPSTTPALTIERLKNEGATVKVV---GELLDEAFELAKALAKNNPGWVYIPP-FDDPLIWEGH-ASIVKE 151
Cdd:COG0031  82 AAKGYRLIIVMPETMSQERRKLLRALGAEVILTpgaPGNMKGAIERAKELAAEIPGYAVWLNqFENPANPEAHyETTGPE 161
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958 152 LKETLWEKPGAIALSVGGGGLLCGVVQGLQEVgWGDVPVIAMETFGAHSFHAATTAGKL--VSLPKITSVakalgvktvg 229
Cdd:COG0031 162 IWQQTDGKVDAFVAGVGTGGTITGVARYLKER-NPNVRIVAVDPEGSVLLSGGEGPHKIegIGAGFVPEN---------- 230
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33469958 230 aqalkLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAvYSHVIQKLQLEGNlrtplpsLVVIVC 303
Cdd:COG0031 231 -----LDLDLIDEVIRVSDEEAIATARRLAREEGLLVGISSGAALAA-ALKLAKELPAGKT-------IVTILP 291
PRK07409 PRK07409
threonine synthase; Validated
11-44 1.50e-03

threonine synthase; Validated


Pssm-ID: 236013  Cd Length: 353  Bit Score: 39.80  E-value: 1.50e-03
                         10        20        30
                 ....*....|....*....|....*....|....
gi 33469958   11 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG 44
Cdd:PRK07409  32 TPLIPAPNLSELLGVEVYVKYEGLNPTGSFKDRG 65
PRK08329 PRK08329
threonine synthase; Validated
24-154 2.74e-03

threonine synthase; Validated


Pssm-ID: 236244 [Multi-domain]  Cd Length: 347  Bit Score: 39.04  E-value: 2.74e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   24 GTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEG 103
Cdd:PRK08329  71 SIKVYFKLDYLQPTGSFKDRGTYVTVAKLKEEGINEVVIDSSGNAALSLALYSLSEGIKVHVFVSYNASKEKISLLSRLG 150
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 33469958  104 ATVKVVG----ELLDEAFELAKalaknNPGWVYIPPFDDPLIWEGHASIVKELKE 154
Cdd:PRK08329 151 AELHFVEgdrmEVHEEAVKFSK-----RNNIPYVSHWLNPYFLEGTKTIAYEIYE 200
PRK06381 PRK06381
threonine synthase; Validated
11-277 7.13e-03

threonine synthase; Validated


Pssm-ID: 235789  Cd Length: 319  Bit Score: 37.76  E-value: 7.13e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   11 TPIRDSMALSKMAGTS-VYLKMDSAQPSGSFKIRGIGHFCKRWAKQG--------CAHFVCSsagnagmaAAYAARQLGV 81
Cdd:PRK06381  16 TPLLRARKLEEELGLRkIYLKFEGANPTGTQKDRIAEAHVRRAMRLGysgitvgtCGNYGAS--------IAYFARLYGL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958   82 PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNpGWVYIPPFD--DPLIWEGHASIVKELKETLWEK 159
Cdd:PRK06381  88 KAVIFIPRSYSNSRVKEMEKYGAEIIYVDGKYEEAVERSRKFAKEN-GIYDANPGSvnSVVDIEAYSAIAYEIYEALGDV 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33469958  160 PGAIAlsvggggllcgvvqglqevgwgdVPVIAMETFGA--HSFHAATTAGKLVSLPKI----TS----VAKAL--GVKT 227
Cdd:PRK06381 167 PDAVA-----------------------VPVGNGTTLAGiyHGFRRLYDRGKTSRMPRMigvsTSggnqIVESFkrGSSE 223
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 33469958  228 VGAQALKLFQEHPIFSEVIS-----DQEAVAAIEK-------FVDDE-----KILVE-------PACGAALAAV 277
Cdd:PRK06381 224 VVDLEVDEIRETAVNEPLVSyrsfdGDNALEAIYDshgyafgFSDDEmvkyaELLRRmeglnalPASASALAAL 297
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH