NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|5881415|ref|NP_007757|]
View 

cytochrome c oxidase subunit I (mitochondrion) [Branchiostoma floridae]

Protein Classification

cytochrome-c oxidase subunit 1( domain architecture ID 10009591)

cytochrome-c oxidase subunit 1 is the catalytic subunit of cytochrome c oxidase, which is the component of the respiratory chain that catalyzes the reduction of oxygen to water

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
COX1 MTH00153
cytochrome c oxidase subunit I; Provisional
5-513 0e+00

cytochrome c oxidase subunit I; Provisional


:

Pssm-ID: 177210  Cd Length: 511  Bit Score: 952.77  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     5 RWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVP 84
Cdd:MTH00153   3 KWLFSTNHKDIGTLYFIFGAWSGMVGTSLSLLIRAELGQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    85 MMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINF 164
Cdd:MTH00153  83 LMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSMVESGAGTGWTVYPPLSSNIAHSGASVDLAIFSLHLAGISSILGAINF 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   165 ITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVY 243
Cdd:MTH00153 163 ITTIINMRSKgMTLDRMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVY 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   244 ILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWL 323
Cdd:MTH00153 243 ILILPGFGMISHIISQESGKKETFGTLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWL 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   324 ATLSGSkQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGF 403
Cdd:MTH00153 323 ATLHGS-QINYSPSLLWALGFVFLFTIGGLTGVVLANSSIDIILHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFTGL 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   404 TLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:MTH00153 402 TMNPKWLKIQFFIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTSWNVISSIGSTISLISILFFIFIIWESMISKRPVL 481
                        490       500       510
                 ....*....|....*....|....*....|
gi 5881415   484 PASHASHSAEWLMGCPPLFHTHEELPFISK 513
Cdd:MTH00153 482 FSLNLSSSIEWLQNLPPAEHSYSELPLLTN 511
 
Name Accession Description Interval E-value
COX1 MTH00153
cytochrome c oxidase subunit I; Provisional
5-513 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177210  Cd Length: 511  Bit Score: 952.77  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     5 RWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVP 84
Cdd:MTH00153   3 KWLFSTNHKDIGTLYFIFGAWSGMVGTSLSLLIRAELGQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    85 MMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINF 164
Cdd:MTH00153  83 LMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSMVESGAGTGWTVYPPLSSNIAHSGASVDLAIFSLHLAGISSILGAINF 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   165 ITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVY 243
Cdd:MTH00153 163 ITTIINMRSKgMTLDRMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVY 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   244 ILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWL 323
Cdd:MTH00153 243 ILILPGFGMISHIISQESGKKETFGTLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWL 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   324 ATLSGSkQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGF 403
Cdd:MTH00153 323 ATLHGS-QINYSPSLLWALGFVFLFTIGGLTGVVLANSSIDIILHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFTGL 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   404 TLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:MTH00153 402 TMNPKWLKIQFFIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTSWNVISSIGSTISLISILFFIFIIWESMISKRPVL 481
                        490       500       510
                 ....*....|....*....|....*....|
gi 5881415   484 PASHASHSAEWLMGCPPLFHTHEELPFISK 513
Cdd:MTH00153 482 FSLNLSSSIEWLQNLPPAEHSYSELPLLTN 511
Cyt_c_Oxidase_I cd01663
Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the ...
10-496 0e+00

Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.


Pssm-ID: 238833  Cd Length: 488  Bit Score: 875.27  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   10 TNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGA 89
Cdd:cd01663   1 TNHKDIGTLYLIFGLWSGLVGTSLSLLIRLELSQPGSQLGNDQLYNVIVTAHALIMIFFMVMPALIGGFGNWLVPLMIGA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   90 PDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFITTIH 169
Cdd:cd01663  81 PDMAFPRLNNLSFWLLPPSLLLLLLSALVEGGAGTGWTVYPPLSSILAHSGPSVDLAIFSLHLAGISSILGAINFITTIF 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  170 NMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYILILP 248
Cdd:cd01663 161 NMRApGMTLEKMPLFVWSVLITAFLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILP 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  249 GFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLATLSG 328
Cdd:cd01663 241 GFGIISHIISTFSGKKPVFGYLGMVYAMLSIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKVFSWLATMWG 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  329 SKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTLQES 408
Cdd:cd01663 321 GS-IKFETPMLWALGFIFLFTIGGLTGVVLANSSLDIALHDTYYVVAHFHYVLSMGAVFAIFAGFYYWFPKITGLSYNET 399
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  409 WTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV-PASH 487
Cdd:cd01663 400 LGKIHFWLMFIGVNLTFFPQHFLGLAGMPRRYPDYPDAYAGWNMISSIGSLISFVSVLLFLFIVWESFVSGRKVIfNVGE 479

                ....*....
gi 5881415  488 ASHSAEWLM 496
Cdd:cd01663 480 GSTSLEWTL 488
CtaD_CoxA TIGR02891
cytochrome c oxidase, subunit I; This large family represents subunit I's (CtaD, CoxA, CaaA) ...
7-503 0e+00

cytochrome c oxidase, subunit I; This large family represents subunit I's (CtaD, CoxA, CaaA) of cytochrome c oxidases of bacterial origin. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits I-III form the functional core of the enzyme complex. Subunit I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit II and heme a of subunit I to the bimetallic center formed by heme a3 and copper B. This cytochrome c oxidase shows proton pump activity across the membrane in addition to the electron transfer. In the bacilli an apparent split (paralogism) has created a sister clade (TIGR02882) encoding subunits (QoxA) of the aa3-type quinone oxidase complex which reacts directly with quinones, bypassing the interaction with soluble cytochrome c. This model attempts to exclude these sequences, placing them between the trusted and noise cutoffs. These families, as well as archaeal and eukaryotic cytochrome c subunit I's are included within the superfamily model, pfam00115. [Energy metabolism, Electron transport]


Pssm-ID: 213748  Cd Length: 499  Bit Score: 559.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415      7 LFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMiGGFGNWLVPMM 86
Cdd:TIGR02891   1 LTTVDHKRIGILYLVTAFAFFLVGGVLALLMRAQLATPGNTFMDAETYNQLFTMHGTIMIFLFAIPIL-AGFGNYLLPLM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     87 IGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFIT 166
Cdd:TIGR02891  80 IGARDMAFPRLNAFSYWLYLFGGLLLLASFFTGGAPDTGWTMYPPLSSTSGSPGVGVDLWLLGLHLLGISSILGAVNFIV 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    167 TIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYIL 245
Cdd:TIGR02891 160 TILNMRApGMTLMRMPLFVWGILVTSILILLAFPVLIAALILLLLDRLFGTHFFDPARGGDPLLWQHLFWFFGHPEVYII 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    246 ILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLAT 325
Cdd:TIGR02891 240 FLPAFGIISEILPTFARK-PIFGYRAMVYATVAIGFLSFGVWAHHMFTTGMPPLALAFFSAATMLIAVPTGVKVFNWIAT 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    326 LSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTL 405
Cdd:TIGR02891 319 LWGGS-IRFTTPMLFALGFIFLFVIGGLTGVMLASVPLDWQLHDTYFVVAHFHYVLVGGSVFAIFAAIYYWFPKVTGRMY 397
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    406 QESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDA--YTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:TIGR02891 398 NERLGRWHFWLTFVGFNLTFFPMHLLGLLGMPRRYYTYPPQmgFATLNLISTIGAFILAAGFLVFLWNLIWSLRKGPKAG 477
                         490       500
                  ....*....|....*....|
gi 5881415    484 PASHASHSAEWLMGCPPLFH 503
Cdd:TIGR02891 478 ANPWGATTLEWTTSSPPPAH 497
CyoB COG0843
Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];
3-511 0e+00

Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];


Pssm-ID: 223913 [Multi-domain]  Cd Length: 566  Bit Score: 556.14  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    3 ITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGAL-LGDDHLYNVIVTAHAFVMIFFMVMPiMIGGFGNW 81
Cdd:COG0843   7 WKRWLTSTDHKDIGILYLILAIFFLLVGGALALLMRLELATPSGSqFLDPQLYNQILTLHGVIMIFFFAMP-AIGGFANY 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   82 LVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVG-TGWTVYPPLSSNIAHaGASVDLAIFSLHLAGVSSILG 160
Cdd:COG0843  86 LVPLMIGARDVAFPRLNAISFWLLVVGAILLVTSFFVPGGAAdTGWTAYPPLSAISYS-GPGVDLFILGLHLLGIGSLLG 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  161 AINFITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:COG0843 165 AINFIVTILNMRAPgMTMMKMPLFTWSILITAILILLAFPVLAAALTMLLLDRNFGTSFFTPAGGGDPLLYQHLFWFFGH 244
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  240 PEVYILILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:COG0843 245 PEVYILILPAFGIVSEIIPTFARK-PLFGYTSMVYAFVAIGILSFIVWAHHMFTTGLPADLRAFFSITTMIIAIPTGIKI 323
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  320 FSWLATLsGSKQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:COG0843 324 FNWLATL-WGGRIRFKTPMLFAIGFIVTFVIGGVTGVLLASIPLDFVVHNTYFVVGHFHYVLGGGVVFGLFAGIYYWFPK 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYP--DAYTIWNVISSLGSIIS-LGSVVFFLFILWEAF 476
Cdd:COG0843 403 MTGRMLNERLGKLHFWLWFIGFNLTFFPMHVLGLMGMPRRYATYPgvPGFTPLNVIATVGAFILgLGVLLFLLNLVVSLR 482
                       490       500       510
                ....*....|....*....|....*....|....*
gi 5881415  477 SSQRKAVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:COG0843 483 KGKRDATGDPWGARTLEWATSSPPPFYNFAELPYK 517
COX1 pfam00115
Cytochrome C and Quinol oxidase polypeptide I;
14-460 7.98e-137

Cytochrome C and Quinol oxidase polypeptide I;


Pssm-ID: 425471  Cd Length: 432  Bit Score: 402.34  E-value: 7.98e-137
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     14 DIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPiMIGGFGNWLVPMMIGAPDMA 93
Cdd:pfam00115   1 RIGLLYLVTALVWFLVGGLLGLLIRLQLAFPGLNFLSPLTYNRLRTLHGNLMIFWFATP-FLFGFGNYLVPLMIGARDMA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     94 FPRMNNMSFWMLPPSFSLLLASSAveaGVGTGWTVYPPLssniahagASVDLAIFSLHLAGVSSILGAINFITTIHNMRA 173
Cdd:pfam00115  80 FPRLNALSFWLVVLGAVLLLASFG---GATTGWTEYPPL--------VGVDLWYIGLLLAGVSSLLGAINFIVTILKRRA 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    174 SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTtffdpsGGGDPILYEHLFWFFGHPEVYILILPGFGII 253
Cdd:pfam00115 149 PGMTLRMPLFVWAILATAILILLAFPVLAAALLLLLLDRSLGA------GGGDPLLDQHLFWWFGHPEVYILILPAFGII 222
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    254 SHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLATLSGSKQLK 333
Cdd:pfam00115 223 YYILPKFAGR-PLFGYRLSVLAFWLIAFLGFLVWAHHLFTTGLPPWLQALFSVFSMLIAVPSGVKVFNWLATLWGGWIRF 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    334 WETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTLQESWTKIH 413
Cdd:pfam00115 302 RTTPMLFFLGFAFLFIIGGLTGVMLALPPVNYYVHDTYFVVAHFHYVLFGGVVFALFGGIYYWLPKLTGRMYSEKLGKLH 381
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|.
gi 5881415    414 FFVMFVGVNLTFFPQHFLGLAGMPRRYS----DYPDAYTIWNVISSLGSII 460
Cdd:pfam00115 382 FWLLFIGFNLTFFPMHILGLLGMPRRYAppfiETVPAFQPLNWIRTIGGVL 432
 
Name Accession Description Interval E-value
COX1 MTH00153
cytochrome c oxidase subunit I; Provisional
5-513 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177210  Cd Length: 511  Bit Score: 952.77  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     5 RWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVP 84
Cdd:MTH00153   3 KWLFSTNHKDIGTLYFIFGAWSGMVGTSLSLLIRAELGQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    85 MMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINF 164
Cdd:MTH00153  83 LMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSMVESGAGTGWTVYPPLSSNIAHSGASVDLAIFSLHLAGISSILGAINF 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   165 ITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVY 243
Cdd:MTH00153 163 ITTIINMRSKgMTLDRMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVY 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   244 ILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWL 323
Cdd:MTH00153 243 ILILPGFGMISHIISQESGKKETFGTLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWL 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   324 ATLSGSkQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGF 403
Cdd:MTH00153 323 ATLHGS-QINYSPSLLWALGFVFLFTIGGLTGVVLANSSIDIILHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFTGL 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   404 TLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:MTH00153 402 TMNPKWLKIQFFIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTSWNVISSIGSTISLISILFFIFIIWESMISKRPVL 481
                        490       500       510
                 ....*....|....*....|....*....|
gi 5881415   484 PASHASHSAEWLMGCPPLFHTHEELPFISK 513
Cdd:MTH00153 482 FSLNLSSSIEWLQNLPPAEHSYSELPLLTN 511
COX1 MTH00167
cytochrome c oxidase subunit I; Provisional
1-511 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177222  Cd Length: 512  Bit Score: 921.77  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00167   1 MWINRWLFSTNHKDIGTLYFIFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00167  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGVSSILG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00167 161 SINFITTIINMKPpGITQYQTPLFVWSILVTTILLLLSLPVLAAAITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00167 241 PEVYILILPGFGMISHIVVYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00167 321 FSWLATLHGGK-IKWETPMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFTHWFPL 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00167 400 FTGLTLNETWTKIHFFVMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNVVSSIGSLISLVAVILFLFIIWEAFSSK 479
                        490       500       510
                 ....*....|....*....|....*....|..
gi 5881415   480 RKAVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:MTH00167 480 RKLLPVELTSTNVEWLHGCPPPHHTWEEPPFV 511
COX1 MTH00116
cytochrome c oxidase subunit I; Provisional
1-511 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177177  Cd Length: 515  Bit Score: 889.83  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00116   1 MFITRWLFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00116  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGVSSILG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMR-ASIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00116 161 AINFITTCINMKpPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00116 241 PEVYILILPGFGIISHIVTYYAGKKEPFGYMGMVWAMLSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGIKV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00116 321 FSWLATLHGGT-IKWDPPMLWALGFIFLFTIGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFTHWFPL 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00116 400 FTGYTLHQTWTKAQFGVMFTGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTISSIGSLISMTAVIMLMFIIWEAFSSK 479
                        490       500       510
                 ....*....|....*....|....*....|..
gi 5881415   480 RKAVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:MTH00116 480 RKVLQPELTTTNIEWIHGCPPPYHTFEEPAFV 511
Cyt_c_Oxidase_I cd01663
Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the ...
10-496 0e+00

Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.


Pssm-ID: 238833  Cd Length: 488  Bit Score: 875.27  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   10 TNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGA 89
Cdd:cd01663   1 TNHKDIGTLYLIFGLWSGLVGTSLSLLIRLELSQPGSQLGNDQLYNVIVTAHALIMIFFMVMPALIGGFGNWLVPLMIGA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   90 PDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFITTIH 169
Cdd:cd01663  81 PDMAFPRLNNLSFWLLPPSLLLLLLSALVEGGAGTGWTVYPPLSSILAHSGPSVDLAIFSLHLAGISSILGAINFITTIF 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  170 NMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYILILP 248
Cdd:cd01663 161 NMRApGMTLEKMPLFVWSVLITAFLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILP 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  249 GFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLATLSG 328
Cdd:cd01663 241 GFGIISHIISTFSGKKPVFGYLGMVYAMLSIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKVFSWLATMWG 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  329 SKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTLQES 408
Cdd:cd01663 321 GS-IKFETPMLWALGFIFLFTIGGLTGVVLANSSLDIALHDTYYVVAHFHYVLSMGAVFAIFAGFYYWFPKITGLSYNET 399
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  409 WTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV-PASH 487
Cdd:cd01663 400 LGKIHFWLMFIGVNLTFFPQHFLGLAGMPRRYPDYPDAYAGWNMISSIGSLISFVSVLLFLFIVWESFVSGRKVIfNVGE 479

                ....*....
gi 5881415  488 ASHSAEWLM 496
Cdd:cd01663 480 GSTSLEWTL 488
COX1 MTH00223
cytochrome c oxidase subunit I; Provisional
5-515 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177260  Cd Length: 512  Bit Score: 844.26  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     5 RWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVP 84
Cdd:MTH00223   2 RWLFSTNHKDIGTLYLIFGMWSGLVGTSLSLLIRAELGQPGALLGDDQLYNVIVTAHAFVMIFFLVMPMMIGGFGNWLVP 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    85 MMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINF 164
Cdd:MTH00223  82 LMLGAPDMAFPRLNNMSFWLLPPSLYLLLSSSAVESGVGTGWTVYPPLSSNLAHAGPSVDLAIFSLHLAGVSSILGAINF 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   165 ITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVY 243
Cdd:MTH00223 162 ITTIINMRSpGMQLERLPLFVWSVKVTAFLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLFWFFGHPEVY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   244 ILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWL 323
Cdd:MTH00223 242 ILILPGFGMISHIVSHYSSKKEVFGTLGMIYAMLSIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWL 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   324 ATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGF 403
Cdd:MTH00223 322 ATIYGSK-IKYEAPMLWALGFIFLFTVGGLTGIILSNSSLDIMLHDTYYVVAHFHYVLSMGAVFALFAGFNHWFPLFTGV 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   404 TLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:MTH00223 401 TLHRRWAKAHFFLMFLGVNLTFFPQHFLGLAGMPRRYSDYPDCYTKWNQVSSFGSMISFVSVLFFMFIVWEAFVSQRSVV 480
                        490       500       510
                 ....*....|....*....|....*....|..
gi 5881415   484 PASHASHSAEWLMGCPPLFHTHEELPFISKKY 515
Cdd:MTH00223 481 WSGHLSTSLEWDNLLPADFHNNSETGALVINP 512
COX1 MTH00142
cytochrome c oxidase subunit I; Provisional
3-509 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 214431  Cd Length: 511  Bit Score: 840.54  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     3 ITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWL 82
Cdd:MTH00142   1 MMRWLFSTNHKDIGTLYFLFGAWAGMVGTGLSLLIRAELGQPGSLLGDDQLYNVIVTAHAFVMIFFMVMPVMIGGFGNWL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    83 VPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAI 162
Cdd:MTH00142  81 VPLMLGAPDMAFPRMNNMSFWLLPPALLLLLSSAAVESGAGTGWTVYPPLSSNLAHSGGSVDLAIFSLHLAGVSSILGAI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   163 NFITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPE 241
Cdd:MTH00142 161 NFITTVINMRAgGMKFERVPLFVWSVKITAILLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLFWFFGHPE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   242 VYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFS 321
Cdd:MTH00142 241 VYILILPGFGMISHIINHYSGKKEVFGTLGMIYAMLSIGLLGFIVWAHHMFTVGMDVDTRAYFTAATMVIAVPTGIKVFS 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   322 WLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFT 401
Cdd:MTH00142 321 WLATLHGSK-VKYEPPMLWALGFIFLFTVGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAVFALFAGFIHWFPLFT 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   402 GFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRK 481
Cdd:MTH00142 400 GLTLNPRWLKAHFYTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNVVSSLGSMISFIAVLMFVFIVWESFVSQRL 479
                        490       500
                 ....*....|....*....|....*...
gi 5881415   482 AVPASHASHSAEWLMGCPPLFHTHEELP 509
Cdd:MTH00142 480 VMWSSHLSTSLEWSHRLPPDFHTYDELP 507
COX1 MTH00183
cytochrome c oxidase subunit I; Provisional
1-511 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177234  Cd Length: 516  Bit Score: 802.22  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00183   1 MAITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00183  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMR-ASIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00183 161 AINFITTIINMKpPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00183 241 PEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSkQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00183 321 FSWLATLHGG-SIKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAAFVHWFPL 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00183 400 FSGYTLHSTWTKIHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVIMFLFILWEAFAAK 479
                        490       500       510
                 ....*....|....*....|....*....|..
gi 5881415   480 RKAVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:MTH00183 480 REVLSVELTSTNVEWLHGCPPPYHTFEEPAFV 511
COX1 MTH00077
cytochrome c oxidase subunit I; Provisional
1-514 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 214419  Cd Length: 514  Bit Score: 786.44  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00077   1 MMITRWLFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00077  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMR-ASIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00077 161 AINFITTSINMKpPSMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00077 241 PEVYILILPGFGMISHIVTYYSAKKEPFGYMGMVWAMMSIGLLGFIVWAHHMFTVDLNVDTRAYFTSATMIIAIPTGVKV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00077 321 FSWLATMHGGA-IKWDAAMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00077 400 FSGYTLHSTWSKIHFGVMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVIMMMFIIWEAFSSK 479
                        490       500       510
                 ....*....|....*....|....*....|....*
gi 5881415   480 RKAVPASHASHSAEWLMGCPPLFHTHEELPFISKK 514
Cdd:MTH00077 480 REVLTTELTSTNIEWLHGCPPPYHTFEEPSFVQTR 514
COX1 MTH00103
cytochrome c oxidase subunit I; Validated
1-511 0e+00

cytochrome c oxidase subunit I; Validated


Pssm-ID: 177165  Cd Length: 513  Bit Score: 784.84  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00103   1 MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00103  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMR-ASIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00103 161 AINFITTIINMKpPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00103 241 PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSkQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00103 321 FSWLATLHGG-NIKWSPAMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPL 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00103 400 FSGYTLNDTWAKIHFTIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVMLMIFMIWEAFASK 479
                        490       500       510
                 ....*....|....*....|....*....|..
gi 5881415   480 RKAVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:MTH00103 480 REVLTVELTTTNLEWLHGCPPPYHTFEEPTYV 511
COX1 MTH00037
cytochrome c oxidase subunit I; Provisional
1-510 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177112  Cd Length: 517  Bit Score: 777.47  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00037   1 MQLSRWLFSTNHKDIGTLYLIFGAWAGMVGTAMSVIIRTELAQPGSLLQDDQIYNVIVTAHALVMIFFMVMPIMIGGFGN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00037  81 WLIPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASAGVESGAGTGWTIYPPLSSNIAHAGGSVDLAIFSLHLAGASSILA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00037 161 SINFITTIINMRTpGMTFDRLPLFVWSVFITAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00037 241 PEVYILILPGFGMISHVIAHYSGKQEPFGYLGMVYAMIAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00037 321 FSWMATLQGSN-LRWETPLLWALGFVFLFTIGGLTGIVLANSSIDVVLHDTYYVVAHFHYVLSMGAVFAIFAGFTHWFPL 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00037 400 FSGVSLHPLWSKVHFFLMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSTISLVATLFFLFLIWEAFASQ 479
                        490       500       510
                 ....*....|....*....|....*....|..
gi 5881415   480 RKAVPASHASHSAEWLMGC-PPLFHTHEELPF 510
Cdd:MTH00037 480 REVISPEFSSSSLEWQYSSfPPSHHTFDETPS 511
COX1 MTH00007
cytochrome c oxidase subunit I; Validated
5-512 0e+00

cytochrome c oxidase subunit I; Validated


Pssm-ID: 133649  Cd Length: 511  Bit Score: 759.05  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     5 RWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVP 84
Cdd:MTH00007   2 RWLYSTNHKDIGTLYFILGVWGGLLGTSMSLLIRIELGQPGAFLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLVP 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    85 MMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINF 164
Cdd:MTH00007  82 LMLGAPDMAFPRLNNMSFWLLPPALILLVSSAAVEKGVGTGWTVYPPLASNLAHAGPSVDLAIFSLHLAGVSSILGAINF 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   165 ITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVY 243
Cdd:MTH00007 162 ITTVINMRWKgLRLERIPLFVWAVVITVVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   244 ILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWL 323
Cdd:MTH00007 242 ILILPGFGAISHIVTHYAGKLEPFGTLGMIYAMLGIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWL 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   324 ATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGF 403
Cdd:MTH00007 322 ATIHGSP-IKYETPMLWALGFIFLFTTGGLTGIVLSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIFAAFNHWFPLFTGL 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   404 TLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:MTH00007 401 TLHDRWAKAHFFLMFLGVNLTFFPQHFLGLSGMPRRYSDYPDAYTKWNVVSSFGSMLSFVALLLFIFILWEAFSAQRGVI 480
                        490       500
                 ....*....|....*....|....*....
gi 5881415   484 PASHASHSAEWLMGCPPLFHTHEELPFIS 512
Cdd:MTH00007 481 ASPHMSSSLEWQDTLPLDFHNLPETGIIT 509
COX1 MTH00182
cytochrome c oxidase subunit I; Provisional
2-515 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 214451  Cd Length: 525  Bit Score: 715.06  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     2 YITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNW 81
Cdd:MTH00182   4 YLTRWVFSTNHKDIGTLYLVFGAGAGMIGTAFSMLIRLELSAPGAMLGDDHLYNVIVTAHAFIMIFFLVMPVMIGGFGNW 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    82 LVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGA 161
Cdd:MTH00182  84 LVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGAGTGWTVYPPLSSIQAHSGGAVDMAIFSLHLAGVSSILGA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   162 INFITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHP 240
Cdd:MTH00182 164 INFITTIFNMRApGVTFNRLPLFVWSILITAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFFGHP 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   241 EVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVF 320
Cdd:MTH00182 244 EVYILILPGFGMISQIIPTFVAKKQIFGYLGMVYAMLSIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVF 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   321 SWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLF 400
Cdd:MTH00182 324 SWLATIYGGT-LRLDTPMLWAMGFVFLFTLGGLTGVVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFGGFYYWFGKI 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   401 TGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQR 480
Cdd:MTH00182 403 TGYCYNELYGKIHFWLMFIGVNLTFFPQHFLGLAGFPRRYSDFADAFAGWNLVSSLGSIISIVGVVWFIYIIYDAYVREE 482
                        490       500       510
                 ....*....|....*....|....*....|....*....
gi 5881415   481 KAVP----ASHASHSAEWLMGCPPLFHTHEELPFISKKY 515
Cdd:MTH00182 483 KFIGwkegTGESWASLEWVHSSPPLFHTYNELPFVYKSK 521
COX1 MTH00184
cytochrome c oxidase subunit I; Provisional
1-514 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177235  Cd Length: 519  Bit Score: 705.43  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     1 MYITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGN 80
Cdd:MTH00184   3 LYLSRWLFSTNHKDIGTLYLLFGAFAGMIGTAFSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGFGN 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:MTH00184  83 WFVPLYIGAPDMAFPRLNNISFWLLPPALTLLLGSAFVEQGAGTGWTVYPPLSSIQAHSGGSVDMAIFSLHLAGISSILG 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:MTH00184 163 AMNFITTIFNMRAPgITMDRMPLFVWSILVTTFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFGH 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:MTH00184 243 PEVYILILPGFGIISQIIPTFAAKKQIFGYLGMVYAMVSIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKI 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSkQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:MTH00184 323 FSWIATIFGG-SLRLDTPMLWAIGFVFLFTMGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAVFAIFGGFYYWFGK 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQ 479
Cdd:MTH00184 402 ITGYCYNEVYGKIHFWLMFIGVNLTFFPQHFLGLAGLPRRYSDFHDSFAGWNQISSLGSVISIVGVVWFIYIVYDAYVRE 481
                        490       500       510
                 ....*....|....*....|....*....|....*...
gi 5881415   480 RKAV---PASHASHSAEWLMGCPPLFHTHEELPFISKK 514
Cdd:MTH00184 482 IKFVgwvEDSGHYPSLEWAQTSPPAHHTYNELPYVYKG 519
COX1 MTH00079
cytochrome c oxidase subunit I; Provisional
6-507 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177148  Cd Length: 508  Bit Score: 670.62  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     6 WLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPM 85
Cdd:MTH00079   7 WLESSNHKDIGTLYFLFGLWSGMVGTSLSLIIRLELSKPGLLLGNGQLYNSVITAHAILMIFFMVMPSMIGGFGNWMLPL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    86 MIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSnIAHAGASVDLAIFSLHLAGVSSILGAINFI 165
Cdd:MTH00079  87 MLGAPDMSFPRLNNLSFWLLPTSLFLILDSCFVDMGPGTSWTVYPPLST-LGHPGSSVDLAIFSLHCAGISSILGGINFM 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   166 TTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYI 244
Cdd:MTH00079 166 VTTKNLRSSsISLEHMSLFVWTVFVTVFLLVLSLPVLAGAITMLLTDRNLNTSFFDPSTGGNPLLYQHLFWFFGHPEVYI 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   245 LILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLA 324
Cdd:MTH00079 246 LILPAFGIISQSTLYLTGKKEVFGSLGMVYAILSIGLIGCVVWAHHMYTVGMDLDSRAYFTAATMVIAVPTGVKVFSWLA 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   325 TLSGSKQlKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFT 404
Cdd:MTH00079 326 TLFGMKM-KFQPLLLWVLGFIFLFTIGGLTGVILSNSSLDIILHDTYYVVSHFHYVLSLGAVFGIFTGISLWWPFMTGIV 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   405 LQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAVP 484
Cdd:MTH00079 405 YDKLMMSAVFFLMFVGVNLTFFPLHFAGLHGMPRKYLDYPDVYSVWNVISSYGSMISVFALFLFIYVLLESFFSYRLVLH 484
                        490       500
                 ....*....|....*....|...
gi 5881415   485 ASHASHSAEWLMGCPPLFHTHEE 507
Cdd:MTH00079 485 DNYINSSPEYSLSSYVFGHSYQS 507
COX1 MTH00026
cytochrome c oxidase subunit I; Provisional
5-511 0e+00

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 164599  Cd Length: 534  Bit Score: 610.09  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     5 RWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVP 84
Cdd:MTH00026   6 RWFFSCNHKDIGSLYLVFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTMIGGFGNWFVP 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    85 MMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINF 164
Cdd:MTH00026  86 LMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAGLSSILGAMNF 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   165 ITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVY 243
Cdd:MTH00026 166 ITTVMNMRTpGMTMSRIPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFGHPEVY 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   244 ILILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWL 323
Cdd:MTH00026 246 ILILPGFGIISQILSLFSYKKQIFGYLGMVYAMLAIGVLGFIVWAHHMYVVGMDVDTRAYFTAATMIIAVPTGIKIFSWL 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   324 ATLSGS-KQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTG 402
Cdd:MTH00026 326 ATVSGSgRNLIFTTPMAWALGFIFLFTIGGLTGIVLSNSSLDILLHDTYYVVAHFHFVLSMGAVFAIFGGFYLWFGKITG 405
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   403 FTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQR-- 480
Cdd:MTH00026 406 YAYKDIYGLIHFWLMFIGVNITFFPQHFLGLAGLPRRYADYPDNFEDFNQISSFGSIISIIAVIWFIVVIFDAYYREEpf 485
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|..
gi 5881415   481 --------KAVPAS-HASH--SAEWLMGCPPLFHTHEELPFI 511
Cdd:MTH00026 486 dinimakgPLIPFScQPAHfdTLEWSLTSPPEHHTYNELPYI 527
Heme_Cu_Oxidase_I cd00919
Heme-copper oxidase subunit I. Heme-copper oxidases are transmembrane protein complexes in ...
12-476 0e+00

Heme-copper oxidase subunit I. Heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and mitochondria which catalyze the reduction of O2 and simultaneously pump protons across the membrane. The superfamily is diverse in terms of electron donors, subunit composition, and heme types. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. Membership in the superfamily is defined by subunit I, which contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme and a copper ion. It also contains a low-spin heme, believed to participate in the transfer of electrons to the binuclear center. Only subunit I is common to the entire superfamily. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from the electron donor on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I of cytochrome c oxidase (CcO) and ubiquinol oxidase. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electron transfer occurs in two segments: from the electron donor to the low-spin heme, and from the low-spin heme to the binuclear center. The first segment can be a multi-step process and varies among the different families, while the second segment, a direct transfer, is consistent throughout the superfamily.


Pssm-ID: 238461  Cd Length: 463  Bit Score: 593.74  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   12 HKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPMmIGAPD 91
Cdd:cd00919   1 HKDIGLLYLIFAFVALLLGGLLALLIRLELATPGSLFLDPQLYNQLVTAHGVIMIFFFVMPAIFGGFGNLLPPL-IGARD 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   92 MAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFITTIHNM 171
Cdd:cd00919  80 LAFPRLNNLSFWLFPPGLLLLLSSVLVGGGAGTGWTFYPPLSTLSYSSGVGVDLAILGLHLAGVSSILGAINFITTILNM 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  172 RAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYILILPGF 250
Cdd:cd00919 160 RAPgMTLDKMPLFVWSVLVTAILLLLALPVLAAALVMLLLDRNFGTSFFDPAGGGDPVLYQHLFWFFGHPEVYILILPAF 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  251 GIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLATLSGSK 330
Cdd:cd00919 240 GAISEIIPTFSGK-PLFGYKLMVYAFLAIGFLSFLVWAHHMFTVGLPVDTRAYFTAATMIIAVPTGIKVFNWLATLWGGR 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  331 qLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTLQESWT 410
Cdd:cd00919 319 -IRFDPPMLFALGFLFLFTIGGLTGVVLANVPLDIVLHDTYYVVAHFHYVLSGGVVFAIFAGLYYWFPKMTGRMLSEKLG 397
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 5881415  411 KIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAF 476
Cdd:cd00919 398 KIHFWLWFIGFNLTFFPMHFLGLLGMPRRYADYPDGFAPWNFISSVGAFILGLGLLLFLGNLFLSL 463
CtaD_CoxA TIGR02891
cytochrome c oxidase, subunit I; This large family represents subunit I's (CtaD, CoxA, CaaA) ...
7-503 0e+00

cytochrome c oxidase, subunit I; This large family represents subunit I's (CtaD, CoxA, CaaA) of cytochrome c oxidases of bacterial origin. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits I-III form the functional core of the enzyme complex. Subunit I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit II and heme a of subunit I to the bimetallic center formed by heme a3 and copper B. This cytochrome c oxidase shows proton pump activity across the membrane in addition to the electron transfer. In the bacilli an apparent split (paralogism) has created a sister clade (TIGR02882) encoding subunits (QoxA) of the aa3-type quinone oxidase complex which reacts directly with quinones, bypassing the interaction with soluble cytochrome c. This model attempts to exclude these sequences, placing them between the trusted and noise cutoffs. These families, as well as archaeal and eukaryotic cytochrome c subunit I's are included within the superfamily model, pfam00115. [Energy metabolism, Electron transport]


Pssm-ID: 213748  Cd Length: 499  Bit Score: 559.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415      7 LFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMiGGFGNWLVPMM 86
Cdd:TIGR02891   1 LTTVDHKRIGILYLVTAFAFFLVGGVLALLMRAQLATPGNTFMDAETYNQLFTMHGTIMIFLFAIPIL-AGFGNYLLPLM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     87 IGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFIT 166
Cdd:TIGR02891  80 IGARDMAFPRLNAFSYWLYLFGGLLLLASFFTGGAPDTGWTMYPPLSSTSGSPGVGVDLWLLGLHLLGISSILGAVNFIV 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    167 TIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYIL 245
Cdd:TIGR02891 160 TILNMRApGMTLMRMPLFVWGILVTSILILLAFPVLIAALILLLLDRLFGTHFFDPARGGDPLLWQHLFWFFGHPEVYII 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    246 ILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLAT 325
Cdd:TIGR02891 240 FLPAFGIISEILPTFARK-PIFGYRAMVYATVAIGFLSFGVWAHHMFTTGMPPLALAFFSAATMLIAVPTGVKVFNWIAT 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    326 LSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTL 405
Cdd:TIGR02891 319 LWGGS-IRFTTPMLFALGFIFLFVIGGLTGVMLASVPLDWQLHDTYFVVAHFHYVLVGGSVFAIFAAIYYWFPKVTGRMY 397
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    406 QESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDA--YTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAV 483
Cdd:TIGR02891 398 NERLGRWHFWLTFVGFNLTFFPMHLLGLLGMPRRYYTYPPQmgFATLNLISTIGAFILAAGFLVFLWNLIWSLRKGPKAG 477
                         490       500
                  ....*....|....*....|
gi 5881415    484 PASHASHSAEWLMGCPPLFH 503
Cdd:TIGR02891 478 ANPWGATTLEWTTSSPPPAH 497
CyoB COG0843
Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];
3-511 0e+00

Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];


Pssm-ID: 223913 [Multi-domain]  Cd Length: 566  Bit Score: 556.14  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    3 ITRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGAL-LGDDHLYNVIVTAHAFVMIFFMVMPiMIGGFGNW 81
Cdd:COG0843   7 WKRWLTSTDHKDIGILYLILAIFFLLVGGALALLMRLELATPSGSqFLDPQLYNQILTLHGVIMIFFFAMP-AIGGFANY 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   82 LVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVG-TGWTVYPPLSSNIAHaGASVDLAIFSLHLAGVSSILG 160
Cdd:COG0843  86 LVPLMIGARDVAFPRLNAISFWLLVVGAILLVTSFFVPGGAAdTGWTAYPPLSAISYS-GPGVDLFILGLHLLGIGSLLG 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  161 AINFITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:COG0843 165 AINFIVTILNMRAPgMTMMKMPLFTWSILITAILILLAFPVLAAALTMLLLDRNFGTSFFTPAGGGDPLLYQHLFWFFGH 244
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  240 PEVYILILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:COG0843 245 PEVYILILPAFGIVSEIIPTFARK-PLFGYTSMVYAFVAIGILSFIVWAHHMFTTGLPADLRAFFSITTMIIAIPTGIKI 323
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  320 FSWLATLsGSKQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:COG0843 324 FNWLATL-WGGRIRFKTPMLFAIGFIVTFVIGGVTGVLLASIPLDFVVHNTYFVVGHFHYVLGGGVVFGLFAGIYYWFPK 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYP--DAYTIWNVISSLGSIIS-LGSVVFFLFILWEAF 476
Cdd:COG0843 403 MTGRMLNERLGKLHFWLWFIGFNLTFFPMHVLGLMGMPRRYATYPgvPGFTPLNVIATVGAFILgLGVLLFLLNLVVSLR 482
                       490       500       510
                ....*....|....*....|....*....|....*
gi 5881415  477 SSQRKAVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:COG0843 483 KGKRDATGDPWGARTLEWATSSPPPFYNFAELPYK 517
COX1 MTH00048
cytochrome c oxidase subunit I; Provisional
6-504 2.43e-179

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177123  Cd Length: 511  Bit Score: 513.46  E-value: 2.43e-179
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     6 WLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPM 85
Cdd:MTH00048   7 WLFTLDHKRIGVIYTLLGVWSGFVGLSLSLLIRLNFLDPYYNVISLDVYNFLITNHGIIMIFFFLMPVLIGGFGNYLLPL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    86 MIGAPDMAFPRMNNMSFWMLPPSFSLLLASsaVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFI 165
Cdd:MTH00048  87 LLGLSDLNLPRLNALSAWLLVPSIVFLLLS--MCLGAGVGWTFYPPLSSSLFSSSWGVDFLMFSLHLAGVSSLFGSINFI 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   166 TTIHNMRASIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYIL 245
Cdd:MTH00048 165 CTIYSAFMTNVFSRTSIILWSYLFTSILLLLSLPVLAAAITMLLFDRNFGSAFFDPLGGGDPVLFQHMFWFFGHPEVYVL 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   246 ILPGFGIISHIIIHYAGKLRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLAT 325
Cdd:MTH00048 245 ILPGFGIISHICLSLSNNDDPFGYYGLVFAMFSIVCLGSVVWAHHMFTVGLDVKTAVFFSSVTMIIGVPTGIKVFSWLYM 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   326 LSGSKQLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTL 405
Cdd:MTH00048 325 LLNSRVRKSDPVVWWVVSFIVLFTIGGVTGIVLSASVLDNVLHDTWFVVAHFHYVLSLGSYSSVVIMFIWWWPLITGLSL 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   406 QESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTIWNVISSLGSIISLGSVVFFLFILWEAFSSQRKAVPA 485
Cdd:MTH00048 405 NKYLLQCHCIISMIGFNLCFFPMHYFGLCGLPRRVCVYEPSYYWINVVCTVGSFISAFSGCFFVFILWESLVVKNEVLGL 484
                        490
                 ....*....|....*....
gi 5881415   486 SHASHSAEWLMGCPPLFHT 504
Cdd:MTH00048 485 WGSSSCVVNVLMSPVPYHN 503
Ubiquinol_Oxidase_I cd01662
Ubiquinol oxidase subunit I. Ubiquinol oxidase, the terminal oxidase in the respiratory ...
6-503 7.74e-170

Ubiquinol oxidase subunit I. Ubiquinol oxidase, the terminal oxidase in the respiratory chains of aerobic bacteria, is a multi-chain transmembrane protein located in the cell membrane. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits in ubiquinol oxidase varies from two to five. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme and a copper ion. It also contains a low-spin heme, believed to participate in the transfer of electrons from ubiquinol to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from ubiquinol on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. It is generally believed that the channels contain water molecules that act as 'proton wires' to transfer the protons. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are believed to be transferred directly from ubiquinol (the electron donor) to the low-spin heme, and directly from the low-spin heme to the binuclear center.


Pssm-ID: 238832  Cd Length: 501  Bit Score: 489.01  E-value: 7.74e-170
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    6 WLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGgFGNWLVPM 85
Cdd:cd01662   1 WLTTVDHKRIGIMYIITAFVFFLRGGVDALLMRTQLALPGNDFLSPEHYNQIFTMHGTIMIFLFAMPLVFG-LMNYLVPL 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   86 MIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILGAINFI 165
Cdd:cd01662  80 QIGARDVAFPRLNALSFWLFLFGGLLLNASLLIGGFPDAGWFAYPPLSGLEYSPGVGVDYWILGLQFSGIGTLLGAINFI 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  166 TTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGHPEVYI 244
Cdd:cd01662 160 VTILKMRApGMTLMRMPIFTWTTLVTSILILFAFPVLTAALALLELDRYFGTHFFTNALGGNPMLWQHLFWIFGHPEVYI 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  245 LILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLA 324
Cdd:cd01662 240 LILPAFGIFSEIVPTFSRK-PLFGYRSMVYATVAIGFLSFGVWVHHMFTTGAGALVNAFFSIATMIIAVPTGVKIFNWLF 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  325 TLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFT 404
Cdd:cd01662 319 TMWRGR-IRFETPMLWAIGFLVTFVIGGLTGVMLASPPADFQVHDTYFVVAHFHYVLIGGVVFPLFAGFYYWFPKMFGRM 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  405 LQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYP--DAYTIWNVISSLGS-IISLGSVVFFLFILWEAFSSQRK 481
Cdd:cd01662 398 LNERLGKWSFWLWFIGFNLTFFPMHILGLMGMPRRVYTYLpgPGWDPLNLISTIGAfLIAAGVLLFLINVIVSIRKGKRD 477
                       490       500
                ....*....|....*....|..
gi 5881415  482 AVPASHASHSAEWLMGCPPLFH 503
Cdd:cd01662 478 ATGDPWGARTLEWATSSPPPAY 499
COX1 pfam00115
Cytochrome C and Quinol oxidase polypeptide I;
14-460 7.98e-137

Cytochrome C and Quinol oxidase polypeptide I;


Pssm-ID: 425471  Cd Length: 432  Bit Score: 402.34  E-value: 7.98e-137
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     14 DIGTLYFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVMIFFMVMPiMIGGFGNWLVPMMIGAPDMA 93
Cdd:pfam00115   1 RIGLLYLVTALVWFLVGGLLGLLIRLQLAFPGLNFLSPLTYNRLRTLHGNLMIFWFATP-FLFGFGNYLVPLMIGARDMA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     94 FPRMNNMSFWMLPPSFSLLLASSAveaGVGTGWTVYPPLssniahagASVDLAIFSLHLAGVSSILGAINFITTIHNMRA 173
Cdd:pfam00115  80 FPRLNALSFWLVVLGAVLLLASFG---GATTGWTEYPPL--------VGVDLWYIGLLLAGVSSLLGAINFIVTILKRRA 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    174 SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTtffdpsGGGDPILYEHLFWFFGHPEVYILILPGFGII 253
Cdd:pfam00115 149 PGMTLRMPLFVWAILATAILILLAFPVLAAALLLLLLDRSLGA------GGGDPLLDQHLFWWFGHPEVYILILPAFGII 222
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    254 SHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKVFSWLATLSGSKQLK 333
Cdd:pfam00115 223 YYILPKFAGR-PLFGYRLSVLAFWLIAFLGFLVWAHHLFTTGLPPWLQALFSVFSMLIAVPSGVKVFNWLATLWGGWIRF 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    334 WETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPLFTGFTLQESWTKIH 413
Cdd:pfam00115 302 RTTPMLFFLGFAFLFIIGGLTGVMLALPPVNYYVHDTYFVVAHFHYVLFGGVVFALFGGIYYWLPKLTGRMYSEKLGKLH 381
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|.
gi 5881415    414 FFVMFVGVNLTFFPQHFLGLAGMPRRYS----DYPDAYTIWNVISSLGSII 460
Cdd:pfam00115 382 FWLLFIGFNLTFFPMHILGLLGMPRRYAppfiETVPAFQPLNWIRTIGGVL 432
CyoB TIGR02843
cytochrome o ubiquinol oxidase, subunit I; Cytochrome o terminal oxidase complex is the ...
4-511 2.49e-117

cytochrome o ubiquinol oxidase, subunit I; Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport]


Pssm-ID: 131890  Cd Length: 646  Bit Score: 359.76  E-value: 2.49e-117
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415      4 TRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAELS-----QPGALlgDDHLYNVIVTAHAFVMIFFMVMPIMIGGF 78
Cdd:TIGR02843  45 NEWLTTVDHKKIGIMYIIVALVMLLRGFADAIMMRTQQAlasggSAGYL--PPHHYDQIFTAHGVIMIFFVAMPFVFGLM 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     79 gNWLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSI 158
Cdd:TIGR02843 123 -NLVVPLQIGARDVAFPFLNSLSFWLTVVGAILVNVSLGVGEFAQTGWLAYPPLSELQYSPGVGVDYYIWALQISGIGTL 201
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    159 LGAINFITTIHNMRAS-IEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFF 237
Cdd:TIGR02843 202 LTGINFFVTIIKMRAPgMTLMKMPVFTWTSLCSNVLIIASFPILTVTLALLTLDRYLGMHFFTNEAGGNPMMYVNLIWAW 281
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    238 GHPEVYILILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGI 317
Cdd:TIGR02843 282 GHPEVYILILPAFGIFSEVVATFSRK-RLFGYTSMVWATIAITVLSFIVWLHHFFTMGAGANVNAFFGIATMIIAIPTGV 360
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    318 KVFSWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWF 397
Cdd:TIGR02843 361 KIFNWLFTMYKGR-IRFETPMLWTIGFMVTFSIGGMTGVLLAVPPADFVLHNSLFLIAHFHNVIIGGVVFGCFAGLTYWF 439
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    398 PLFTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDYPD-AYTIWNVISSLGSIISLGSVVFFLFILWEAF 476
Cdd:TIGR02843 440 PKAFGFKLNEKLGKRSFWCWFIGFYLAFMPLYILGFMGMTRRLNHYDNpEWHPMLIIAAFGAFLIACGILCQIIQIFVSI 519
                         490       500       510
                  ....*....|....*....|....*....|....*...
gi 5881415    477 SSQRK---AVPASHASHSAEWLMGCPPLFHTHEELPFI 511
Cdd:TIGR02843 520 RDRDQnrdTTGDPWGGRTLEWSTSSPPPFYNFAVIPKV 557
PRK15017 PRK15017
cytochrome o ubiquinol oxidase subunit I; Provisional
4-514 2.42e-99

cytochrome o ubiquinol oxidase subunit I; Provisional


Pssm-ID: 184978  Cd Length: 663  Bit Score: 313.41  E-value: 2.42e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415     4 TRWLFSTNHKDIGTLYFIFGAWAAMVGTAMSLLIRAE--LSQPG-ALLGDDHLYNVIVTAHAFVMIFFMVMPIMIGgFGN 80
Cdd:PRK15017  46 KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQqaLASAGeAGFLPPHHYDQIFTAHGVIMIFFVAMPFVIG-LMN 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415    81 WLVPMMIGAPDMAFPRMNNMSFWMLPPSFSLLLASSAVEAGVGTGWTVYPPLSSNIAHAGASVDLAIFSLHLAGVSSILG 160
Cdd:PRK15017 125 LVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLT 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   161 AINFITTIHNMRA-SIEWNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLTDRNINTTFFDPSGGGDPILYEHLFWFFGH 239
Cdd:PRK15017 205 GINFFVTILKMRApGMTMFKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGH 284
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   240 PEVYILILPGFGIISHIIIHYAGKlRSFGYLGMTWAMFTIGLLGFWVWAHHMFTVGMDVDTRSYFTAATMVIAVPTGIKV 319
Cdd:PRK15017 285 PEVYILILPVFGVFSEIAATFSRK-RLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTGVKI 363
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   320 FSWLATLSGSKqLKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFSILAGLTYWFPL 399
Cdd:PRK15017 364 FNWLFTMYQGR-IVFHSAMLWTIGFIVTFSVGGMTGVLLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPK 442
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   400 FTGFTLQESWTKIHFFVMFVGVNLTFFPQHFLGLAGMPRRYSDY--PDAYTIWNVISSLGSIISLG--SVVFFLFILWEA 475
Cdd:PRK15017 443 AFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMTRRLSQQidPQFHTMLMIAASGAALIALGilCQVIQMYVSIRD 522
                        490       500       510
                 ....*....|....*....|....*....|....*....
gi 5881415   476 FSSQRKAVPASHASHSAEWLMGCPPLFHTHEELPFISKK 514
Cdd:PRK15017 523 RDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHER 561
ba3-like_Oxidase_I cd01660
ba3-like heme-copper oxidase subunit I. The ba3 family of heme-copper oxidases are ...
19-472 1.14e-23

ba3-like heme-copper oxidase subunit I. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively. For general information on the heme-copper oxidase superfamily, please see cd00919.


Pssm-ID: 238830  Cd Length: 473  Bit Score: 103.91  E-value: 1.14e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   19 YFIFGAWAAMVGTAMSLLIRAELSQPGALLGDDHLYNVIVTAHAFVM-IFFMVMPIMigGFGNWLVPMMIGAPDMAfPRM 97
Cdd:cd01660   9 HFVVAFLALLLGGLFGLLQVLVRTGVFPLPSSGILYYQGLTLHGVLLaIVFTTFFIM--GFFYAIVARALLRSLFN-RRL 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415   98 NNMSFWMLppSFSLLLASSAVEAGVGTG-WTVYPPLssnIAHAGASVDLAIFSlhlagVSSILGAINFITTIHNMRASIE 176
Cdd:cd01660  86 AWAGFWLM--VIGTVMAAVPILLGQASVlYTFYPPL---QAHPLFYIGAALVV-----VGSWISGFAMFVTLWRWKKANP 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  177 WNRVPLFVWSIWVTAYLLLLSLPVLAGAITMLLtdrnINTTFFDpSGGGDPILYEHLFWFFGHPEVYILILPGFGIISHI 256
Cdd:cd01660 156 GKKVPLATFMVVTTMILWLVASLGVALEVLFQL----LPWSLGL-VDTVDVLLSRTLFWWFGHPLVYFWLLPAYIAWYTI 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  257 IIHYAG-KLRSFGYLGMTWAMFTigLLGFWVWAHHMFT-VGMDVDTRSYFTAATMVIAVPTGIKVFSWLATLS------- 327
Cdd:cd01660 231 LPKIAGgKLFSDPLARLAFILFL--LFSTPVGFHHQFAdPGIGPGWKFIHMVLTFMVALPSLLTAFTVFASLEiagrlrg 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  328 GSKQLKWETPLLW--------ALGFIFlFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSmGAVFSILAGLTYWF-P 398
Cdd:cd01660 309 GKGLFGWIRALPWgdpmflalFLAMLM-FIPGGAGGIINASYQLNYVVHNTAWVPGHFHLTVG-GAVALTFMAVAYWLvP 386
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881415  399 LFTGFTLQESW-TKIHFFVMFVGVNLTFFPQHFLGLAGMPRR--YSDYPDAY-----TIWNVISSLGSIISLGSVVFFLF 470
Cdd:cd01660 387 HLTGRELAAKRlALAQPWLWFVGMTIMSTAMHVAGLLGAPRRtaEAQYGGLPaagewAPYQQLMAIGGTILFVSGALFLY 466

                ..
gi 5881415  471 IL 472
Cdd:cd01660 467 IL 468
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH