NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|5881422|ref|NP_007762|]
View 

NADH dehydrogenase subunit 3 (mitochondrion) [Branchiostoma floridae]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Oxidored_q4 super family cl00535
NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;
1-117 2.59e-39

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;


The actual alignment was detected with superfamily member MTH00136:

Pssm-ID: 444962 [Multi-domain]  Cd Length: 116  Bit Score: 127.34  E-value: 2.59e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     1 MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGV 80
Cdd:MTH00136   1 MNLITTILTITIALSLILAIVSFWLPQMTPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGD 80
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 5881422    81 VFSENTFYNYWlVMLLVVVLTFGLMYEWLKGGLEWTE 117
Cdd:MTH00136  81 QLPSPLLTFFW-ATAVLILLTLGLIYEWLQGGLEWAE 116
 
Name Accession Description Interval E-value
ND3 MTH00136
NADH dehydrogenase subunit 3; Provisional
1-117 2.59e-39

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177194 [Multi-domain]  Cd Length: 116  Bit Score: 127.34  E-value: 2.59e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     1 MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGV 80
Cdd:MTH00136   1 MNLITTILTITIALSLILAIVSFWLPQMTPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGD 80
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 5881422    81 VFSENTFYNYWlVMLLVVVLTFGLMYEWLKGGLEWTE 117
Cdd:MTH00136  81 QLPSPLLTFFW-ATAVLILLTLGLIYEWLQGGLEWAE 116
Oxidored_q4 pfam00507
NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;
30-114 2.66e-27

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;


Pssm-ID: 425725 [Multi-domain]  Cd Length: 94  Bit Score: 95.95  E-value: 2.66e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     30 PDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYplGVVFSENTFYNYWLVMLLVVVLTFGLMYEWL 109
Cdd:pfam00507  12 PNPEKLSPYECGFDPVGDARLRFSVRFYLVAILFLIFDVEVVFLFPW--AVSFRELGWFGFVEMLIFIAILLVGLVYAWK 89

                  ....*
gi 5881422    110 KGGLE 114
Cdd:pfam00507  90 KGALE 94
NuoA COG0838
NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];
7-115 1.19e-19

NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];


Pssm-ID: 223908 [Multi-domain]  Cd Length: 123  Bit Score: 77.64  E-value: 1.19e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    7 IVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALIlpYPLGVVFSENT 86
Cdd:COG0838  14 FLVVALLLGVLMLFLSKLLGPRRPNPEKLSPYECGNPPFGGARLRFSVQYYLVAILFVVFDVEVVFL--FPWAVSFKELG 91
                        90       100
                ....*....|....*....|....*....
gi 5881422   87 FYNYWLVMLLVVVLTFGLMYEWLKGGLEW 115
Cdd:COG0838  92 LFGFLEMLVFIFVLLVGFVYAWKKGALEW 120
 
Name Accession Description Interval E-value
ND3 MTH00136
NADH dehydrogenase subunit 3; Provisional
1-117 2.59e-39

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177194 [Multi-domain]  Cd Length: 116  Bit Score: 127.34  E-value: 2.59e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     1 MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGV 80
Cdd:MTH00136   1 MNLITTILTITIALSLILAIVSFWLPQMTPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGD 80
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 5881422    81 VFSENTFYNYWlVMLLVVVLTFGLMYEWLKGGLEWTE 117
Cdd:MTH00136  81 QLPSPLLTFFW-ATAVLILLTLGLIYEWLQGGLEWAE 116
ND3 MTH00069
NADH dehydrogenase subunit 3; Provisional
25-117 1.26e-36

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177141 [Multi-domain]  Cd Length: 114  Bit Score: 120.48  E-value: 1.26e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    25 LPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWlVMLLVVVLTFGL 104
Cdd:MTH00069  23 LPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPTPWASQLNTPTNTLFW-STLILILLTLGL 101
                         90
                 ....*....|...
gi 5881422   105 MYEWLKGGLEWTE 117
Cdd:MTH00069 102 IYEWIQGGLEWAE 114
ND3 MTH00113
NADH dehydrogenase subunit 3; Provisional
3-116 8.81e-35

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177175 [Multi-domain]  Cd Length: 114  Bit Score: 115.75  E-value: 8.81e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     3 SLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVF 82
Cdd:MTH00113   2 NLISMLTISLALSTILTTLNFWLTQTKPDNEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAINL 81
                         90       100       110
                 ....*....|....*....|....*....|....
gi 5881422    83 SENTFYNYWlVMLLVVVLTFGLMYEWLKGGLEWT 116
Cdd:MTH00113  82 TTPTTTLTW-ATIILTLLTLGLIYEWLQGGLEWA 114
ND3 MTH00203
NADH dehydrogenase subunit 3; Provisional
1-115 2.59e-34

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214456 [Multi-domain]  Cd Length: 112  Bit Score: 114.61  E-value: 2.59e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     1 MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGV 80
Cdd:MTH00203   1 MNLIMLFFLIALLLSLILLFIAFWLPKVNPDGEKLSPYECGFDPLGSARLPFSLQFFLVALSFLLFDLEIALLLPLPWSN 80
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 5881422    81 VFSentFYNYWLVMLLVVVLTFGLMYEWLKGGLEW 115
Cdd:MTH00203  81 QLS---SLSLLLAFLFLILLTLGLIYEWLQGGLEW 112
ND3 MTH00042
NADH dehydrogenase subunit 3; Validated
1-117 2.65e-32

NADH dehydrogenase subunit 3; Validated


Pssm-ID: 177117 [Multi-domain]  Cd Length: 116  Bit Score: 109.69  E-value: 2.65e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     1 MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGV 80
Cdd:MTH00042   1 MTNLIFFLLIILILTSLLLLAGHFLPSRSPDLEKSSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPPAT 80
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 5881422    81 VFSeNTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE 117
Cdd:MTH00042  81 LIT-NPSTLLPISLIFLIILTIGLVYEWVNGGLEWAE 116
ND3 MTH00106
NADH dehydrogenase subunit 3; Provisional
25-117 2.41e-29

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177168 [Multi-domain]  Cd Length: 115  Bit Score: 101.94  E-value: 2.41e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    25 LPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSeNTFYNYWLVMLLVVVLTFGL 104
Cdd:MTH00106  24 LPQLNIYSEKASPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTN-NLNTMLTMALLLISLLALSL 102
                         90
                 ....*....|...
gi 5881422   105 MYEWLKGGLEWTE 117
Cdd:MTH00106 103 AYEWTQKGLEWTE 115
ND3 MTH00055
NADH dehydrogenase subunit 3; Provisional
30-115 2.43e-27

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177128 [Multi-domain]  Cd Length: 118  Bit Score: 97.09  E-value: 2.43e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    30 PDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYplGVVFSENTFYNYWLVMLLVVVLTFGLMYEWL 109
Cdd:MTH00055  34 PDSEKVSVYECGFDPFESSRIPFSVRFFLVGILFLIFDLEISFLFPW--CVVYNQIGLFGFWVMYLFLIILTIGLIYEWV 111

                 ....*.
gi 5881422   110 KGGLEW 115
Cdd:MTH00055 112 KGGLEW 117
Oxidored_q4 pfam00507
NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;
30-114 2.66e-27

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;


Pssm-ID: 425725 [Multi-domain]  Cd Length: 94  Bit Score: 95.95  E-value: 2.66e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422     30 PDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYplGVVFSENTFYNYWLVMLLVVVLTFGLMYEWL 109
Cdd:pfam00507  12 PNPEKLSPYECGFDPVGDARLRFSVRFYLVAILFLIFDVEVVFLFPW--AVSFRELGWFGFVEMLIFIAILLVGLVYAWK 89

                  ....*
gi 5881422    110 KGGLE 114
Cdd:pfam00507  90 KGALE 94
ND3 MTH00161
NADH dehydrogenase subunit 3; Provisional
31-115 1.62e-25

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177217 [Multi-domain]  Cd Length: 113  Bit Score: 92.15  E-value: 1.62e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    31 DNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLgVVFSENTFYNYWLVMLLVVVLTFGLMYEWLK 110
Cdd:MTH00161  30 DREKSSPFECGFDPKSSARLPFSLRFFLIAIIFLIFDVEIALLLPMIF-IFKTSNMMSWLITSSFFILILLLGLYYEWNQ 108

                 ....*
gi 5881422   111 GGLEW 115
Cdd:MTH00161 109 GALEW 113
ND3 MTH00018
NADH dehydrogenase subunit 3; Validated
30-115 1.69e-25

NADH dehydrogenase subunit 3; Validated


Pssm-ID: 164592 [Multi-domain]  Cd Length: 113  Bit Score: 92.05  E-value: 1.69e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    30 PDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYplGVVFSENTFYNYWLVMLLVVVLTFGLMYEWL 109
Cdd:MTH00018  29 PDREKVSAYECGFDPFGFPGRPFSIRFFLIGILFLIFDLEISFLFPW--CVLYNQIAPFGFWTMVGFLFILTLGLIYEWI 106

                 ....*.
gi 5881422   110 KGGLEW 115
Cdd:MTH00018 107 KGGLEW 112
ND3 MTH00148
NADH dehydrogenase subunit 3; Provisional
31-117 1.13e-23

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214433 [Multi-domain]  Cd Length: 117  Bit Score: 87.61  E-value: 1.13e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    31 DNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYpLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLK 110
Cdd:MTH00148  32 DREKSSPFECGFDPISSARSPFSLRFFLLAILFLVFDVEIVLLFPV-LQSLGSSFSVWSLTSLFIFLLILILGLFHEWNE 110

                 ....*..
gi 5881422   111 GGLEWTE 117
Cdd:MTH00148 111 GSLDWVS 117
PRK06602 PRK06602
NADH:ubiquinone oxidoreductase subunit A; Validated
30-116 3.42e-23

NADH:ubiquinone oxidoreductase subunit A; Validated


Pssm-ID: 180638 [Multi-domain]  Cd Length: 121  Bit Score: 86.46  E-value: 3.42e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    30 PDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALIlpYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWL 109
Cdd:PRK06602  37 PDREKNSPYESGFEAFGDARMKFDVRFYLVAILFVIFDLEAAFL--FPWAVSFREIGWLGFVEAMIFILVLLVGLVYLWR 114

                 ....*..
gi 5881422   110 KGGLEWT 116
Cdd:PRK06602 115 KGALDWE 121
ND3 MTH00030
NADH dehydrogenase subunit 3; Provisional
27-115 1.47e-22

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 164603 [Multi-domain]  Cd Length: 123  Bit Score: 84.98  E-value: 1.47e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    27 SVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYplGVVFSENTFYNYWLVMLLVVVLTFGLMY 106
Cdd:MTH00030  36 LTKPDSEKSSIYECGFDPFGKIRTPFTIKFVLVGILFMIFDIEISFLFPW--SIVFNQLNLFSFWIVYTFLIVLAIGLAY 113

                 ....*....
gi 5881422   107 EWLKGGLEW 115
Cdd:MTH00030 114 EWIKGGLEW 122
ND3 MTH00202
NADH dehydrogenase subunit 3; Provisional
27-115 2.04e-21

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214455 [Multi-domain]  Cd Length: 117  Bit Score: 81.96  E-value: 2.04e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    27 SVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLgVVFSENTFYNYWLVMLLVVVLTFGLMY 106
Cdd:MTH00202  28 RSLMDREKSSPFECGFDPKESARLPFSMRFFLLAVIFLVFDIEIALLLPLPL-VLKSSWSKGGLLGGTIFLLILIGGLIH 106

                 ....*....
gi 5881422   107 EWLKGGLEW 115
Cdd:MTH00202 107 EWKEGSLDW 115
ND3 MTH00012
NADH dehydrogenase subunit 3; Validated
31-116 2.37e-20

NADH dehydrogenase subunit 3; Validated


Pssm-ID: 164588 [Multi-domain]  Cd Length: 117  Bit Score: 79.13  E-value: 2.37e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    31 DNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLgVVFSENTFYNYWLVMLLVVVLTFGLMYEWLK 110
Cdd:MTH00012  32 DREKTSPFECGFDPHKTARIPFSLRFFLLAIIFIVFDIEIVLLMPVPT-ILMTSTSKTVVYTSILFLLILVIGLIHEWRE 110

                 ....*.
gi 5881422   111 GGLEWT 116
Cdd:MTH00012 111 GSLDWS 116
NuoA COG0838
NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];
7-115 1.19e-19

NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];


Pssm-ID: 223908 [Multi-domain]  Cd Length: 123  Bit Score: 77.64  E-value: 1.19e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    7 IVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALIlpYPLGVVFSENT 86
Cdd:COG0838  14 FLVVALLLGVLMLFLSKLLGPRRPNPEKLSPYECGNPPFGGARLRFSVQYYLVAILFVVFDVEVVFL--FPWAVSFKELG 91
                        90       100
                ....*....|....*....|....*....
gi 5881422   87 FYNYWLVMLLVVVLTFGLMYEWLKGGLEW 115
Cdd:COG0838  92 LFGFLEMLVFIFVLLVGFVYAWKKGALEW 120
ndhC CHL00022
NADH dehydrogenase subunit 3
33-116 2.15e-12

NADH dehydrogenase subunit 3


Pssm-ID: 176964 [Multi-domain]  Cd Length: 120  Bit Score: 58.85  E-value: 2.15e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    33 EKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIalILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGG 112
Cdd:CHL00022  39 EKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVFDVET--VFLYPWAMSFDVLGVSAFIEALIFVLILIVGLVYAWRKGA 116

                 ....
gi 5881422   113 LEWT 116
Cdd:CHL00022 117 LEWS 120
PRK07928 PRK07928
NADH dehydrogenase subunit A; Validated
34-116 7.10e-10

NADH dehydrogenase subunit A; Validated


Pssm-ID: 181171 [Multi-domain]  Cd Length: 119  Bit Score: 52.37  E-value: 7.10e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    34 KLSAYECGFDPMGNARLP--FSLRFFLVAILFLLFDLEIalILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKG 111
Cdd:PRK07928  37 KLEAYECGIEPTPQPAGGgrFPVKYYLTAMLFIVFDIEI--VFLYPWAVSFDALGVFGLVEMALFMLTVFVAYAYVWRRG 114

                 ....*
gi 5881422   112 GLEWT 116
Cdd:PRK07928 115 GLEWD 119
PRK07756 PRK07756
NADH-quinone oxidoreductase subunit A;
30-115 8.09e-09

NADH-quinone oxidoreductase subunit A;


Pssm-ID: 169084 [Multi-domain]  Cd Length: 122  Bit Score: 49.74  E-value: 8.09e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    30 PDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALIlpYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWL 109
Cdd:PRK07756  38 PSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFL--YPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWK 115

                 ....*.
gi 5881422   110 KGGLEW 115
Cdd:PRK07756 116 KKVLQW 121
PRK08489 PRK08489
NAD(P)H-quinone oxidoreductase subunit 3;
34-115 2.73e-07

NAD(P)H-quinone oxidoreductase subunit 3;


Pssm-ID: 181448 [Multi-domain]  Cd Length: 129  Bit Score: 45.81  E-value: 2.73e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    34 KLSAYECGFDPMGNARlPFSLRFFLVAILFLLFDLEIalILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGL 113
Cdd:PRK08489  47 KLAIYECGPEPVKQPN-RISSHFYIMALLFILFDVEI--VFMFPWAVDFKLLGLFGLIEMLLFIVLLTIGFIYAWKKGAL 123

                 ..
gi 5881422   114 EW 115
Cdd:PRK08489 124 EW 125
ND3 MTH00092
NADH dehydrogenase subunit 3; Provisional
34-116 1.72e-05

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177155  Cd Length: 111  Bit Score: 40.65  E-value: 1.72e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    34 KLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALIlpypLGVVFSEntFYNYWLVMLLVVVLTFGLMYEWLKGGL 113
Cdd:MTH00092  34 KVSSFECGFESVGKIQNSFSIHFFKIMLMFVIFDLEIVMF----LGLLVSD--FSSLISFFMLMIFIFFGFYMEWWYGKL 107

                 ...
gi 5881422   114 EWT 116
Cdd:MTH00092 108 IWV 110
ND3 MTH00060
NADH dehydrogenase subunit 3; Provisional
31-116 1.78e-05

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177132  Cd Length: 116  Bit Score: 40.65  E-value: 1.78e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5881422    31 DNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALIlpypLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLK 110
Cdd:MTH00060  34 GFSWVSSFECGFFSSGLSENCFSFTYFFLLVFFVIFDLEISLL----LNMPFQGLLFYNFWYYYFFLLLLFLGFVVELFS 109

                 ....*.
gi 5881422   111 GGLEWT 116
Cdd:MTH00060 110 GYVRWV 115
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH