NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|87239967|ref|NP_031795|]
View 

deleted in malignant brain tumors 1 protein isoform 2 precursor [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1613-1860 1.92e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


:

Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.39  E-value: 1.92e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1613 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1688
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1689 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1766
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1767 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1842
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 87239967    1843 VCRAYDTSSRCYRGCVVR 1860
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
324-424 1.39e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 174.07  E-value: 1.39e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     324 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 403
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     404 SHRGWLSHNCGHHEDAGVICS 424
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
741-841 1.06e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.06e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     741 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 820
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     821 SHRGWLSHNCGHHEDAGVICS 841
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1371-1470 1.08e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.08e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1371 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1450
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 87239967    1451 HHPGWLVHNCRHSEDAGVIC 1470
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
463-563 1.19e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.19e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     463 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 542
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     543 SHRGWLSHNCGHHEDAGVICS 563
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
37-137 2.21e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.60  E-value: 2.21e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967      37 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 116
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     117 SHRGWLSHNCGHQEDAGVICS 137
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
186-286 3.62e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 3.62e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     186 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 265
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     266 SHQGWLSHNCGHQEDAGVICS 286
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
602-702 8.68e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 8.68e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     602 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 681
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     682 SHRGWLSHNCGHHEDAGVICS 702
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1494-1602 8.37e-38

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 137.93  E-value: 8.37e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1494 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1569
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1570 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1602
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1126-1234 8.79e-35

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.45  E-value: 8.79e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1126 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1201
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1202 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1234
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1000-1108 2.30e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 2.30e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1000 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1075
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1076 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1108
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
884-992 3.52e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.53  E-value: 3.52e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967  884 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 959
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967  960 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 992
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1242-1350 1.51e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.91  E-value: 1.51e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1242 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1317
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1318 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1350
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1613-1860 1.92e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.39  E-value: 1.92e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1613 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1688
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1689 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1766
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1767 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1842
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 87239967    1843 VCRAYDTSSRCYRGCVVR 1860
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
Zona_pellucida pfam00100
Zona pellucida-like domain;
1613-1858 2.03e-51

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 182.06  E-value: 2.03e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1613 CQSNHMQASVSRSYLQSMGYsARDLVIPGWNSSyHCQPqiTQREVIFTIPYTGCGTIKQADNETINYSNFLRA--VVSNG 1690
Cdd:pfam00100    1 CTVDTIVSSISQNPTLPSLL-LDEVSLLGGDDA-TCSP--VGATVIFEFPSTACGTVFQVIGTVKIYSNRLYAstDVGWI 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1691 IIKRRKDLNIHVSCKMLQNTWVNTmyitnntveiqEVQYGNFDVNISFYTSSSFLFPVTSSPYYVDLDQNLYLQAEILHS 1770
Cdd:pfam00100   77 TRSITRKLRVYFRASYDSSSAVNV-----------GSGSGVLLMSLDLYKSESYSVYYVPYPVTKLLRQPVYVEVELLSR 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1771 -DASLALFVDTCVASPHPNDFSSLTY-DLIRSGCVRDDTY----------QSYSSPSPRVSRFKFSSFHFLNRF----PS 1834
Cdd:pfam00100  146 tDPNLNLLLDLCWATPSANPTSDIIWwDICVDGCDNTDDSyysprlpvtvTSVNNYPSHYKRFFFFMFTFVDDTdalsGQ 225
                          250       260
                   ....*....|....*....|....
gi 87239967   1835 VYLQCKLVVCRAydTSSRCYRGCV 1858
Cdd:pfam00100  226 VYLHCSASQCSS--NSNCCADSCR 247
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
324-424 1.39e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 174.07  E-value: 1.39e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     324 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 403
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     404 SHRGWLSHNCGHHEDAGVICS 424
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
741-841 1.06e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.06e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     741 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 820
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     821 SHRGWLSHNCGHHEDAGVICS 841
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1371-1470 1.08e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.08e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1371 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1450
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 87239967    1451 HHPGWLVHNCRHSEDAGVIC 1470
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
463-563 1.19e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.19e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     463 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 542
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     543 SHRGWLSHNCGHHEDAGVICS 563
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
37-137 2.21e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.60  E-value: 2.21e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967      37 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 116
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     117 SHRGWLSHNCGHQEDAGVICS 137
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
186-286 3.62e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 3.62e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     186 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 265
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     266 SHQGWLSHNCGHQEDAGVICS 286
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
602-702 8.68e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 8.68e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     602 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 681
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     682 SHRGWLSHNCGHHEDAGVICS 702
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
1376-1471 5.28e-43

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 152.13  E-value: 5.28e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1376 GSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAP-GNAWFGQG-SGLIVLDDVSCSGYESHLWNCHHP 1453
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967   1454 GWLVHNCRHSEDAGVICA 1471
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
468-563 8.16e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 148.66  E-value: 8.16e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    468 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 545
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    546 GWLSHNCGHHEDAGVICS 563
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
607-702 8.16e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 148.66  E-value: 8.16e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    607 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 684
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    685 GWLSHNCGHHEDAGVICS 702
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
42-137 2.19e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 147.51  E-value: 2.19e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     42 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GNARFGQG-SGPIVMDDVACGGYEDYLWRCSHR 119
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    120 GWLSHNCGHQEDAGVICS 137
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
746-841 5.96e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.35  E-value: 5.96e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    746 GGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWSCSHR 823
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    824 GWLSHNCGHHEDAGVICS 841
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
329-424 8.46e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 145.97  E-value: 8.46e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    329 GGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWRCSHR 406
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    407 GWLSHNCGHHEDAGVICS 424
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
191-286 7.07e-39

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 140.19  E-value: 7.07e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    191 GGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAP-GNAYFGQGQ-GPIVLDDVACGGYENYLWSCSHQ 268
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGStGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    269 GWLSHNCGHQEDAGVICS 286
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1494-1602 8.37e-38

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 137.93  E-value: 8.37e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1494 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1569
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1570 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1602
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB pfam00431
CUB domain;
1494-1600 2.74e-35

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 130.49  E-value: 2.74e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1494 CGGFLTQPSGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCdGSL 1571
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEdhDECGYDYVEIRDGPSASSPLLGRFC-GSG 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 87239967   1572 GS--FTSTSNFMSIRFITDHSITARGFQAHY 1600
Cdd:pfam00431   80 IPedIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1126-1234 8.79e-35

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.45  E-value: 8.79e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1126 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1201
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1202 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1234
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1000-1108 2.30e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 2.30e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1000 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1075
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1076 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1108
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
884-992 3.52e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.53  E-value: 3.52e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967  884 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 959
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967  960 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 992
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1503-1600 1.62e-33

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 125.20  E-value: 1.62e-33
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1503 GQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCDGSLGS--FTSTS 1578
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLEssDNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1579 NFMSIRFITDHSITARGFQAHY 1600
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1242-1350 1.51e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.91  E-value: 1.51e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1242 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1317
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1318 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1350
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1135-1232 6.43e-32

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 120.57  E-value: 6.43e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1135 GQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1210
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1211 NFMSVVFITDGSVTRRGFQAHY 1232
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
893-990 3.22e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.65  E-value: 3.22e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     893 GQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 968
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967     969 NFMSVVFITDGSVTRRGFQAHY 990
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1009-1106 4.53e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.26  E-value: 4.53e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1009 GQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVCDGSNGS--FTSTG 1084
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1085 NFMSVVFITDGSVTRRGFQAHY 1106
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
1126-1232 1.51e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 117.01  E-value: 1.51e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1126 CGGLLTLPSGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1202
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967   1203 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1232
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1242-1348 6.42e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 6.42e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1242 CGGLLTQPSGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVC-DGF 1318
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967   1319 NGSFTSTGNFMSVVFITDGSVTRRGFQAYY 1348
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
884-990 7.21e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 7.21e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    884 CGGLLTQPSGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 960
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967    961 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 990
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1000-1106 1.38e-29

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 114.31  E-value: 1.38e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1000 CGGLLTQPSGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVC-DGS 1076
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967   1077 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1106
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1251-1348 1.65e-29

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 113.64  E-value: 1.65e-29
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1251 GQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVCDGFNGS--FTSTG 1326
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1327 NFMSVVFITDGSVTRRGFQAYY 1348
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1613-1860 1.92e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.39  E-value: 1.92e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1613 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1688
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1689 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1766
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1767 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1842
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 87239967    1843 VCRAYDTSSRCYRGCVVR 1860
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
Zona_pellucida pfam00100
Zona pellucida-like domain;
1613-1858 2.03e-51

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 182.06  E-value: 2.03e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1613 CQSNHMQASVSRSYLQSMGYsARDLVIPGWNSSyHCQPqiTQREVIFTIPYTGCGTIKQADNETINYSNFLRA--VVSNG 1690
Cdd:pfam00100    1 CTVDTIVSSISQNPTLPSLL-LDEVSLLGGDDA-TCSP--VGATVIFEFPSTACGTVFQVIGTVKIYSNRLYAstDVGWI 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1691 IIKRRKDLNIHVSCKMLQNTWVNTmyitnntveiqEVQYGNFDVNISFYTSSSFLFPVTSSPYYVDLDQNLYLQAEILHS 1770
Cdd:pfam00100   77 TRSITRKLRVYFRASYDSSSAVNV-----------GSGSGVLLMSLDLYKSESYSVYYVPYPVTKLLRQPVYVEVELLSR 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1771 -DASLALFVDTCVASPHPNDFSSLTY-DLIRSGCVRDDTY----------QSYSSPSPRVSRFKFSSFHFLNRF----PS 1834
Cdd:pfam00100  146 tDPNLNLLLDLCWATPSANPTSDIIWwDICVDGCDNTDDSyysprlpvtvTSVNNYPSHYKRFFFFMFTFVDDTdalsGQ 225
                          250       260
                   ....*....|....*....|....
gi 87239967   1835 VYLQCKLVVCRAydTSSRCYRGCV 1858
Cdd:pfam00100  226 VYLHCSASQCSS--NSNCCADSCR 247
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
324-424 1.39e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 174.07  E-value: 1.39e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     324 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 403
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     404 SHRGWLSHNCGHHEDAGVICS 424
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
741-841 1.06e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.06e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     741 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 820
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     821 SHRGWLSHNCGHHEDAGVICS 841
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1371-1470 1.08e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.08e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1371 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1450
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 87239967    1451 HHPGWLVHNCRHSEDAGVIC 1470
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
463-563 1.19e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 171.37  E-value: 1.19e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     463 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 542
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     543 SHRGWLSHNCGHHEDAGVICS 563
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
37-137 2.21e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.60  E-value: 2.21e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967      37 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 116
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     117 SHRGWLSHNCGHQEDAGVICS 137
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
186-286 3.62e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 3.62e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     186 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 265
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     266 SHQGWLSHNCGHQEDAGVICS 286
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
602-702 8.68e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 8.68e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     602 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 681
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 87239967     682 SHRGWLSHNCGHHEDAGVICS 702
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
1376-1471 5.28e-43

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 152.13  E-value: 5.28e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1376 GSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAP-GNAWFGQG-SGLIVLDDVSCSGYESHLWNCHHP 1453
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967   1454 GWLVHNCRHSEDAGVICA 1471
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
468-563 8.16e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 148.66  E-value: 8.16e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    468 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 545
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    546 GWLSHNCGHHEDAGVICS 563
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
607-702 8.16e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 148.66  E-value: 8.16e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    607 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 684
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    685 GWLSHNCGHHEDAGVICS 702
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
42-137 2.19e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 147.51  E-value: 2.19e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     42 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GNARFGQG-SGPIVMDDVACGGYEDYLWRCSHR 119
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    120 GWLSHNCGHQEDAGVICS 137
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
746-841 5.96e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.35  E-value: 5.96e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    746 GGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWSCSHR 823
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    824 GWLSHNCGHHEDAGVICS 841
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
329-424 8.46e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 145.97  E-value: 8.46e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    329 GGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWRCSHR 406
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    407 GWLSHNCGHHEDAGVICS 424
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
191-286 7.07e-39

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 140.19  E-value: 7.07e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    191 GGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAP-GNAYFGQGQ-GPIVLDDVACGGYENYLWSCSHQ 268
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGStGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 87239967    269 GWLSHNCGHQEDAGVICS 286
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1494-1602 8.37e-38

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 137.93  E-value: 8.37e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1494 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1569
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1570 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1602
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB pfam00431
CUB domain;
1494-1600 2.74e-35

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 130.49  E-value: 2.74e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1494 CGGFLTQPSGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCdGSL 1571
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEdhDECGYDYVEIRDGPSASSPLLGRFC-GSG 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 87239967   1572 GS--FTSTSNFMSIRFITDHSITARGFQAHY 1600
Cdd:pfam00431   80 IPedIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1126-1234 8.79e-35

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.45  E-value: 8.79e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1126 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1201
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1202 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1234
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1000-1108 2.30e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 2.30e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1000 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1075
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1076 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1108
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
884-992 3.52e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.53  E-value: 3.52e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967  884 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 959
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967  960 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 992
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1503-1600 1.62e-33

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 125.20  E-value: 1.62e-33
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1503 GQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCDGSLGS--FTSTS 1578
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLEssDNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1579 NFMSIRFITDHSITARGFQAHY 1600
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1242-1350 1.51e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.91  E-value: 1.51e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967 1242 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1317
Cdd:cd00041    1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 87239967 1318 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1350
Cdd:cd00041   81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1135-1232 6.43e-32

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 120.57  E-value: 6.43e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1135 GQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1210
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1211 NFMSVVFITDGSVTRRGFQAHY 1232
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
893-990 3.22e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.65  E-value: 3.22e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967     893 GQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 968
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967     969 NFMSVVFITDGSVTRRGFQAHY 990
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1009-1106 4.53e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.26  E-value: 4.53e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1009 GQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVCDGSNGS--FTSTG 1084
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1085 NFMSVVFITDGSVTRRGFQAHY 1106
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
1126-1232 1.51e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 117.01  E-value: 1.51e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1126 CGGLLTLPSGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1202
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967   1203 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1232
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1242-1348 6.42e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 6.42e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1242 CGGLLTQPSGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVC-DGF 1318
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967   1319 NGSFTSTGNFMSVVFITDGSVTRRGFQAYY 1348
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
884-990 7.21e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 7.21e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    884 CGGLLTQPSGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 960
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967    961 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 990
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1000-1106 1.38e-29

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 114.31  E-value: 1.38e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967   1000 CGGLLTQPSGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVC-DGS 1076
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 87239967   1077 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1106
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1251-1348 1.65e-29

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 113.64  E-value: 1.65e-29
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 87239967    1251 GQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVCDGFNGS--FTSTG 1326
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 87239967    1327 NFMSVVFITDGSVTRRGFQAYY 1348
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH