NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6681161|ref|NP_031869|]
View 

beta-defensin 1 precursor [Mus musculus]

Protein Classification

Defensin_beta domain-containing protein (domain architecture ID 10464978)

Defensin_beta domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Defensin_beta pfam00711
Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of ...
33-68 8.14e-07

Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.


:

Pssm-ID: 395579  Cd Length: 36  Bit Score: 40.69  E-value: 8.14e-07
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 6681161    33 DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCK 68
Cdd:pfam00711  1 DPVSCRRNGGICRPGRCPGLERQIGTCGGGKLKCCR 36
 
Name Accession Description Interval E-value
Defensin_beta pfam00711
Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of ...
33-68 8.14e-07

Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.


Pssm-ID: 395579  Cd Length: 36  Bit Score: 40.69  E-value: 8.14e-07
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 6681161    33 DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCK 68
Cdd:pfam00711  1 DPVSCRRNGGICRPGRCPGLERQIGTCGGGKLKCCR 36
 
Name Accession Description Interval E-value
Defensin_beta pfam00711
Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of ...
33-68 8.14e-07

Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.


Pssm-ID: 395579  Cd Length: 36  Bit Score: 40.69  E-value: 8.14e-07
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 6681161    33 DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCK 68
Cdd:pfam00711  1 DPVSCRRNGGICRPGRCPGLERQIGTCGGGKLKCCR 36
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH