NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|110626102|ref|NP_033039|]
View 

RAD51-associated protein 1 isoform 1 [Mus musculus]

Protein Classification

Roughex and RAD51_interact domain-containing protein (domain architecture ID 13505566)

Roughex and RAD51_interact domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RAD51_interact pfam15696
RAD51 interacting motif; This motif interacts with RAD51.
293-331 9.02e-13

RAD51 interacting motif; This motif interacts with RAD51.


:

Pssm-ID: 406187  Cd Length: 39  Bit Score: 61.56  E-value: 9.02e-13
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 110626102  293 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 331
Cdd:pfam15696   1 GSSGSSSGILRGVPVKSPSQPLRLGLSRLARVKPLHPYL 39
PTZ00108 super family cl36510
DNA topoisomerase 2-like protein; Provisional
2-204 2.46e-04

DNA topoisomerase 2-like protein; Provisional


The actual alignment was detected with superfamily member PTZ00108:

Pssm-ID: 240271 [Multi-domain]  Cd Length: 1388  Bit Score: 43.11  E-value: 2.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102    2 VRPIRNRKPINYSQFEDSGNDSDDDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKRVALDDKvfqRG 81
Cdd:PTZ00108 1196 GNSKRVDSDEKRKLDDKPDNKKSNSSGSDQEDDEEQKTKPKKSSVKRLKSKKNNSSKSSEDNDEFSSDDLSKEGK---PK 1272
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102   82 LEVALALSVKELPTLTNQVKKSKEKSTDKQGKEKTENTGKPphVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAK 161
Cdd:PTZ00108 1273 NAPKRVSAVQYSPPPPSKRPDGESNGGSKPSSPTKKKVKKR--LEGSLAALKKKKKSEKKTARKKKSKTRVKQASASQSS 1350
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 110626102  162 APRRRAPSEGSDGSSANDTESesatgEGSESDPDFDESKESDE 204
Cdd:PTZ00108 1351 RLLRRPRKKKSDSSSEDDDDS-----EVDDSEDEDDEDDEDDD 1388
 
Name Accession Description Interval E-value
RAD51_interact pfam15696
RAD51 interacting motif; This motif interacts with RAD51.
293-331 9.02e-13

RAD51 interacting motif; This motif interacts with RAD51.


Pssm-ID: 406187  Cd Length: 39  Bit Score: 61.56  E-value: 9.02e-13
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 110626102  293 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 331
Cdd:pfam15696   1 GSSGSSSGILRGVPVKSPSQPLRLGLSRLARVKPLHPYL 39
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
2-204 2.46e-04

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271 [Multi-domain]  Cd Length: 1388  Bit Score: 43.11  E-value: 2.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102    2 VRPIRNRKPINYSQFEDSGNDSDDDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKRVALDDKvfqRG 81
Cdd:PTZ00108 1196 GNSKRVDSDEKRKLDDKPDNKKSNSSGSDQEDDEEQKTKPKKSSVKRLKSKKNNSSKSSEDNDEFSSDDLSKEGK---PK 1272
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102   82 LEVALALSVKELPTLTNQVKKSKEKSTDKQGKEKTENTGKPphVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAK 161
Cdd:PTZ00108 1273 NAPKRVSAVQYSPPPPSKRPDGESNGGSKPSSPTKKKVKKR--LEGSLAALKKKKKSEKKTARKKKSKTRVKQASASQSS 1350
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 110626102  162 APRRRAPSEGSDGSSANDTESesatgEGSESDPDFDESKESDE 204
Cdd:PTZ00108 1351 RLLRRPRKKKSDSSSEDDDDS-----EVDDSEDEDDEDDEDDD 1388
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
74-205 2.00e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 39.81  E-value: 2.00e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  74 DDKVFQRGlEVALALSVKELPTLTNQVKKSKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGE 153
Cdd:NF000535 687 DDKDADGG-EVDVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 765
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 110626102 154 RKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDED 205
Cdd:NF000535 766 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 817
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
100-310 3.45e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 39.29  E-value: 3.45e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 100 VKKSK-------EKSTDKQGK--EKTENTGKPPhvsncsvasddvedldkiTEEGDASSVEGERKspsqakaprrraPSE 170
Cdd:PTZ00449 489 IKKSKkklapieEEDSDKHDEppEGPEASGLPP------------------KAPGDKEGEEGEHE------------DSK 538
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 171 GSDGSSANDTESESATGE-GSESDPdfdeskesdedfgVRRSKESKKKTVQKKPAGEKKERKSK-PKCEASVTSVDPAPA 248
Cdd:PTZ00449 539 ESDEPKEGGKPGETKEGEvGKKPGP-------------AKEHKPSKIPTLSKKPEFPKDPKHPKdPEEPKKPKRPRSAQR 605
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 110626102 249 AIKSGSPSLPQAVGLPseatRKPAIMCSPSAESKRPKWVPPAASGSRNSSSNALAGTPAKSP 310
Cdd:PTZ00449 606 PTRPKSPKLPELLDIP----KSPKRPESPKSPKRPPPPQRPSSPERPEGPKIIKSPKPPKSP 663
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
97-205 6.36e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 38.27  E-value: 6.36e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  97 TNQVKKSKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSS 176
Cdd:NF000535 717 TSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 796
                         90       100
                 ....*....|....*....|....*....
gi 110626102 177 ANDTESESATGEGSESDPDFDESKESDED 205
Cdd:NF000535 797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSD 825
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
91-205 7.44e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 38.27  E-value: 7.44e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  91 KELPTLTNQVKKSKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSE 170
Cdd:NF000535 715 EETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 794
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 110626102 171 GSDGSSANDTESESATGEGSESDPDFDESKESDED 205
Cdd:NF000535 795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 829
MSCRAMM_ClfB NF033845
MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial ...
103-226 7.90e-03

MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411414 [Multi-domain]  Cd Length: 871  Bit Score: 38.00  E-value: 7.90e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 103 SKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTES 182
Cdd:NF033845 693 SDSDSDSDSSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 772
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 110626102 183 ESATGEGSESDPDFDESKESDEDFGVRRSKESKKKTVQKKPAGE 226
Cdd:NF033845 773 DSDSDSDSDSDSDSDSDSDSDSDSDSRVTPPNNEQKAPSNPKGE 816
 
Name Accession Description Interval E-value
RAD51_interact pfam15696
RAD51 interacting motif; This motif interacts with RAD51.
293-331 9.02e-13

RAD51 interacting motif; This motif interacts with RAD51.


Pssm-ID: 406187  Cd Length: 39  Bit Score: 61.56  E-value: 9.02e-13
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 110626102  293 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 331
Cdd:pfam15696   1 GSSGSSSGILRGVPVKSPSQPLRLGLSRLARVKPLHPYL 39
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
2-204 2.46e-04

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271 [Multi-domain]  Cd Length: 1388  Bit Score: 43.11  E-value: 2.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102    2 VRPIRNRKPINYSQFEDSGNDSDDDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKRVALDDKvfqRG 81
Cdd:PTZ00108 1196 GNSKRVDSDEKRKLDDKPDNKKSNSSGSDQEDDEEQKTKPKKSSVKRLKSKKNNSSKSSEDNDEFSSDDLSKEGK---PK 1272
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102   82 LEVALALSVKELPTLTNQVKKSKEKSTDKQGKEKTENTGKPphVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAK 161
Cdd:PTZ00108 1273 NAPKRVSAVQYSPPPPSKRPDGESNGGSKPSSPTKKKVKKR--LEGSLAALKKKKKSEKKTARKKKSKTRVKQASASQSS 1350
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 110626102  162 APRRRAPSEGSDGSSANDTESesatgEGSESDPDFDESKESDE 204
Cdd:PTZ00108 1351 RLLRRPRKKKSDSSSEDDDDS-----EVDDSEDEDDEDDEDDD 1388
PTZ00459 PTZ00459
mucin-associated surface protein (MASP); Provisional
94-258 1.86e-03

mucin-associated surface protein (MASP); Provisional


Pssm-ID: 185638 [Multi-domain]  Cd Length: 291  Bit Score: 39.38  E-value: 1.86e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  94 PTLTNQVKKSKEKSTDKQGKEKTENTGKPPhvsncSVASDDVEDLDKITEEGDASS--VEGERKSPSQAKAprrrapseG 171
Cdd:PTZ00459  42 PPESKGLETSSQGTQDLKGGAAGAKENSPP-----LPTEEDDEDVDDDSEEGDDDDggAEDEEEEKVRGQS--------G 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 172 SDGSSANDTESESATGEGSESDPDFdeSKESDEDFGVRRSKESKKKTVQKKPAGEKKERKSKPKCEASVTSV---DPAPA 248
Cdd:PTZ00459 109 QEGTVALGSGSTEKKLIGSEKQTEL--SISSAESISPSGSRELNVNLTQTEVEGKKETDKNTPAVENPLTTGngeNTLPA 186
                        170
                 ....*....|
gi 110626102 249 AIKSGSPSLP 258
Cdd:PTZ00459 187 GIVEGNPSPP 196
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
74-205 2.00e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 39.81  E-value: 2.00e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  74 DDKVFQRGlEVALALSVKELPTLTNQVKKSKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGE 153
Cdd:NF000535 687 DDKDADGG-EVDVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 765
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 110626102 154 RKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDED 205
Cdd:NF000535 766 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 817
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
100-310 3.45e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 39.29  E-value: 3.45e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 100 VKKSK-------EKSTDKQGK--EKTENTGKPPhvsncsvasddvedldkiTEEGDASSVEGERKspsqakaprrraPSE 170
Cdd:PTZ00449 489 IKKSKkklapieEEDSDKHDEppEGPEASGLPP------------------KAPGDKEGEEGEHE------------DSK 538
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 171 GSDGSSANDTESESATGE-GSESDPdfdeskesdedfgVRRSKESKKKTVQKKPAGEKKERKSK-PKCEASVTSVDPAPA 248
Cdd:PTZ00449 539 ESDEPKEGGKPGETKEGEvGKKPGP-------------AKEHKPSKIPTLSKKPEFPKDPKHPKdPEEPKKPKRPRSAQR 605
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 110626102 249 AIKSGSPSLPQAVGLPseatRKPAIMCSPSAESKRPKWVPPAASGSRNSSSNALAGTPAKSP 310
Cdd:PTZ00449 606 PTRPKSPKLPELLDIP----KSPKRPESPKSPKRPPPPQRPSSPERPEGPKIIKSPKPPKSP 663
PLN02967 PLN02967
kinase
87-207 3.81e-03

kinase


Pssm-ID: 215521  Cd Length: 581  Bit Score: 38.87  E-value: 3.81e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  87 ALSVKELPTLTNQVKKSKEKSTDKQGKEKT--ENTGKPPHVSNCSVASDDVEDLDKI-----TEEGDASSVEGERKSPSQ 159
Cdd:PLN02967  55 ALAVDEEPDENGAVSKKKPTRSVKRATKKTvvEISEPLEEGSELVVNEDAALDKESKktprrTRRKAAAASSDVEEEKTE 134
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 110626102 160 AKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDEDFG 207
Cdd:PLN02967 135 KKVRKRRKVKKMDEDVEDQGSESEVSDVEESEFVTSLENESEEELDLE 182
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
143-335 4.57e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 39.00  E-value: 4.57e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  143 EEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDEDFGVRRSKESKKKTVQKK 222
Cdd:PHA03307  208 RRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGPASS 287
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  223 PAGEKKERKSKPKCEASVTSVDPAPAAIKSGSPSLPQAVGLPSEATRKPAIM-------CSPSAESKRPKWVPPAASGSR 295
Cdd:PHA03307  288 SSSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSESSRGAavspgpsPSRSPSPSRPPPPADPSSPRK 367
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 110626102  296 NSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSATSSQ 335
Cdd:PHA03307  368 RPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRF 407
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
97-205 6.36e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 38.27  E-value: 6.36e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  97 TNQVKKSKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSS 176
Cdd:NF000535 717 TSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 796
                         90       100
                 ....*....|....*....|....*....
gi 110626102 177 ANDTESESATGEGSESDPDFDESKESDED 205
Cdd:NF000535 797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSD 825
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
91-205 7.44e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 38.27  E-value: 7.44e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102  91 KELPTLTNQVKKSKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSE 170
Cdd:NF000535 715 EETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 794
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 110626102 171 GSDGSSANDTESESATGEGSESDPDFDESKESDED 205
Cdd:NF000535 795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 829
MSCRAMM_ClfB NF033845
MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial ...
103-226 7.90e-03

MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411414 [Multi-domain]  Cd Length: 871  Bit Score: 38.00  E-value: 7.90e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110626102 103 SKEKSTDKQGKEKTENTGKPPHVSNCSVASDDVEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTES 182
Cdd:NF033845 693 SDSDSDSDSSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 772
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 110626102 183 ESATGEGSESDPDFDESKESDEDFGVRRSKESKKKTVQKKPAGE 226
Cdd:NF033845 773 DSDSDSDSDSDSDSDSDSDSDSDSDSRVTPPNNEQKAPSNPKGE 816
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH