NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6677883|ref|NP_033165|]
View 

C-C motif chemokine 6 precursor [Mus musculus]

Protein Classification

C-C motif chemokine (domain architecture ID 10084499)

C-C motif chemokine recruits and activates leukocytes, and plays a major role in both immune response and inflammation-related diseases

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Chemokine_CC cd00272
Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
50-105 5.55e-19

Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; some members (e.g. 2HCC) contain an additional disulfide bond which is thought to compensate for the highly conserved Trp missing in these; chemotatic for monocytes, macrophages, eosinophils, basophils, and T cells, but not neutrophils; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses; a subgroup of CC, identified by an N-terminal DCCL motif (Exodus-1, Exodus-2, and Exodus-3), has been shown to inhibit specific types of human cancer cell growth in a mouse model. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups, and Chemokine_CC_DCCL for the DCCL subgroup of this CD.


:

Pssm-ID: 238170  Cd Length: 57  Bit Score: 73.82  E-value: 5.55e-19
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 6677883   50 CCFSYATQ-IPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLK 105
Cdd:cd00272   1 CCLSYSKKrIPLRVLKSYRRTSSSCSKPAVIFKTKRGREVCADPKQKWVQRYMKLLD 57
 
Name Accession Description Interval E-value
Chemokine_CC cd00272
Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
50-105 5.55e-19

Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; some members (e.g. 2HCC) contain an additional disulfide bond which is thought to compensate for the highly conserved Trp missing in these; chemotatic for monocytes, macrophages, eosinophils, basophils, and T cells, but not neutrophils; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses; a subgroup of CC, identified by an N-terminal DCCL motif (Exodus-1, Exodus-2, and Exodus-3), has been shown to inhibit specific types of human cancer cell growth in a mouse model. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups, and Chemokine_CC_DCCL for the DCCL subgroup of this CD.


Pssm-ID: 238170  Cd Length: 57  Bit Score: 73.82  E-value: 5.55e-19
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 6677883   50 CCFSYATQ-IPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLK 105
Cdd:cd00272   1 CCLSYSKKrIPLRVLKSYRRTSSSCSKPAVIFKTKRGREVCADPKQKWVQRYMKLLD 57
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
47-101 4.58e-18

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 71.51  E-value: 4.58e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 6677883      47 SSDCCFSYATQ-IPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCL 101
Cdd:smart00199   1 PLRCCLSYTSKkIPLKRIKSYYPTSSHCPKPAVIFTTKKGRKVCADPKAKWVQRYI 56
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
48-104 1.72e-15

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 395003  Cd Length: 60  Bit Score: 64.97  E-value: 1.72e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 6677883     48 SDCCFSYATQ-IPCKRFIYYF--PTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTL 104
Cdd:pfam00048   1 SDCCLRYSSKpIPLKRVKSYEiqPPSSSCPKPAVIFLTKKGRQVCADPKQKWVQRLIKKL 60
 
Name Accession Description Interval E-value
Chemokine_CC cd00272
Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
50-105 5.55e-19

Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; some members (e.g. 2HCC) contain an additional disulfide bond which is thought to compensate for the highly conserved Trp missing in these; chemotatic for monocytes, macrophages, eosinophils, basophils, and T cells, but not neutrophils; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses; a subgroup of CC, identified by an N-terminal DCCL motif (Exodus-1, Exodus-2, and Exodus-3), has been shown to inhibit specific types of human cancer cell growth in a mouse model. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups, and Chemokine_CC_DCCL for the DCCL subgroup of this CD.


Pssm-ID: 238170  Cd Length: 57  Bit Score: 73.82  E-value: 5.55e-19
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 6677883   50 CCFSYATQ-IPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLK 105
Cdd:cd00272   1 CCLSYSKKrIPLRVLKSYRRTSSSCSKPAVIFKTKRGREVCADPKQKWVQRYMKLLD 57
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
47-101 4.58e-18

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 71.51  E-value: 4.58e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 6677883      47 SSDCCFSYATQ-IPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCL 101
Cdd:smart00199   1 PLRCCLSYTSKkIPLKRIKSYYPTSSHCPKPAVIFTTKKGRKVCADPKAKWVQRYI 56
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
48-104 1.72e-15

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 395003  Cd Length: 60  Bit Score: 64.97  E-value: 1.72e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 6677883     48 SDCCFSYATQ-IPCKRFIYYF--PTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTL 104
Cdd:pfam00048   1 SDCCLRYSSKpIPLKRVKSYEiqPPSSSCPKPAVIFLTKKGRQVCADPKQKWVQRLIKKL 60
Chemokine cd00169
Chemokine: small cytokines, including a number of secreted growth factors and interferons ...
50-105 5.93e-11

Chemokine: small cytokines, including a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; distinguished from other cytokines by their receptors, which are G-protein coupled receptors; divided into 4 subfamilies based on the arrangement of the two N-terminal cysteines; some members can bind multiple receptors and many chemokine receptors can bind more than one chemokine; this redundancy allows precise control in stimulating the immune system and in contributing to the homeostasis of a cell; when expressed inappropriately, chemokines play a role in autoimmune diseases, vascular irregularities, graft rejection, neoplasia, and allergies; exist as monomers, dimers and multimers, but are believed to function as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine_CXC (cd00273), Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for chemokine subgroups.


Pssm-ID: 238098  Cd Length: 59  Bit Score: 53.50  E-value: 5.93e-11
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 6677883   50 CCFSYATQ-IPCKRFIYYFPTSGG--CIKPGIIFISRRGTQVCADPSDRRVQRCLSTLK 105
Cdd:cd00169   1 CCLKYTSKpIPPKNIKSYRVQEAGghCSIPAVIFTTKKGRKVCADPKEPWVKDLIQKLD 59
Chemokine_CC_DCCL cd01119
Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL ...
49-104 4.81e-09

Chemokine_CC_DCCL: subgroup of the Chemokine_CC subgroup based on the presence of a DCCL motif involving the two N-terminal cysteine residues; includes a number of small inducible cytokines capable of reversibly inhibiting normal hematopoietic progenitor proliferation by blocking progression through the cell cycle; DCCL subgroup contains Exodus-1 (also known as CCL20, MIP-3alpha, LARC, ST38 (mouse)), Exodus-2 (also known as CCL21, SLC, 6-Ckine, TCA4, CKbeta9), and Exodus-3 (also known as CCL-19, ELC, MIP-3beta, CKbeta11). Exodus-3 was shown to inhibit the growth of human breast cancer cells in vivo in a mouse model; Exodus-1, -2, and -3 were all shown to significantly inhibit chronic myelogenous leukemia progenitor cell proliferation; Exodus-2 and -3 show potent immunotherapeutic activity toward solid tumors; chemotatic for T cells, B cells, dendritic cells, macrophage progenitor cells, and NK cells; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates. See CDs: Chemokine_CC (cd00272) for the entire CC subgroup, Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238539  Cd Length: 61  Bit Score: 48.55  E-value: 4.81e-09
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 6677883   49 DCCFSYA-TQIPCK--RFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTL 104
Cdd:cd01119   2 DCCLSYTqHPIPWRvlRGYTYQEISESCDIPAIIFHTRRGRKVCADPKQDWVKRAIQLL 60
Chemokine_C cd00271
Chemokine_C, C or lymphotactin subgroup, 1 of 4 subgroup designations of chemokines based on ...
51-104 8.41e-04

Chemokine_C, C or lymphotactin subgroup, 1 of 4 subgroup designations of chemokines based on the arrangement of two N-terminal, conserved cysteine residues. Most of the known chemokines (cd00169) belong to either the CC (cd00272) or CXC (cd00273) subclass. The two other subclasses each have a single known member: fractalkine for the CX3C (cd00274) class and lymphotactin for the C (cd00271) class. Chemokine_Cs differ structurally since they contain only one of the two disulfide bridges that are conserved in all other chemokines and they possess a unique C-terminal extension, which is required for biological activity and thought to play a role in receptor binding. Lymphotactin, a mediator of mucosal immunity, has been found to chemoattract neutrophils and B cells through the XCR1 receptor and thought to be a factor in acute allograft rejection and inflammatory bowel disease.


Pssm-ID: 238169  Cd Length: 72  Bit Score: 35.22  E-value: 8.41e-04
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*
gi 6677883   51 CFSYATQ-IPCKRFIYYFPTSGGCikPGIIFISRRGTQVCADPSDRRVQRCLSTL 104
Cdd:cd00271  11 CVSLTTQrLPVQKIKTYTIKEGSV--RAVIFITKRGLKICADPQAKWVKSAVKTI 63
Chemokine_CX3C cd00274
Chemokine_CX3C: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
51-104 3.20e-03

Chemokine_CX3C: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteines; differ structurally from the other subgroups in that they are attached to a membrane-spanning domain via a mucin-like stalk and can be proteolytically cleaved to a freely diffusible form; chemotatic for T cells, monocytes, and natural killer cells; function as monomers and are found only in vertebrates and a few viruses; currently only fractalkine (sometimes called neurotactin) has been identified as a member of this subfamily; the primary source of fractalkine is neurons, and they exhibit cell adhesion and chemoattractive properties in the central nervous system. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_CC (cd00272), and Chemokine_C (cd00271) for the additional chemokine subgroups.


Pssm-ID: 238172  Cd Length: 76  Bit Score: 33.89  E-value: 3.20e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 6677883   51 CFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTL 104
Cdd:cd00274  12 CSKMTSKIPVALLIHYQQNQESCGKRAIILETRQHRLFCADPKEQWVKDAMQHL 65
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH