NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|124249092|ref|NP_033606|]
View 

zona pellucida sperm-binding protein 1 precursor [Mus musculus]

Protein Classification

Trefoil and ZP domain-containing protein (domain architecture ID 12184327)

Trefoil and ZP domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
271-541 8.61e-71

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


:

Pssm-ID: 214579  Cd Length: 252  Bit Score: 229.20  E-value: 8.61e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   271 QCFkSGYFTLVMSQETALTHGVLLDNVHLAyaPNGCPP--TQKTSAFVVFHVPLTLCGTAIQVVGEQLIYENQLVsdidV 348
Cdd:smart00241   1 QCG-EDQMVVSVSTDLLFPGGINVKGLTLG--DPSCRPqfTDATSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLV----V 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   349 QKGPQGSITRDSAFRLHVRCIFNASDFLPIQASIFS-PQPPAPVTQSGPLRLELRIATDKTFSSYYQGSDYPLvrllREP 427
Cdd:smart00241  74 SPFHPGFITRDDRAAYHFQCFYPENEKVSLNLDVSTiPPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYVL----GDP 149
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   428 VYVEVRLLQRTDPSLVLVLHQCWATPTTSPFEQPQWPILSDGCPFkgDNYRTQVVAADREalpfWSHYQRFTITTFMLLD 507
Cdd:smart00241 150 VYHEWECDGADDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPV--DGYLDSTIPYNSN----PLHRARFSVKVFKFAD 223
                          250       260       270
                   ....*....|....*....|....*....|....*
gi 124249092   508 sssqnalRGQVYFFCSASACHPLGSDTCST-TCDS 541
Cdd:smart00241 224 -------RSLVYFHCQIRLCDKDDGSSCDGpACSS 251
PD smart00018
P or trefoil or TFF domain; Proposed role in renewal and pathology of mucous epithelia.
226-268 2.76e-10

P or trefoil or TFF domain; Proposed role in renewal and pathology of mucous epithelia.


:

Pssm-ID: 197472  Cd Length: 46  Bit Score: 55.85  E-value: 2.76e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 124249092   226 ERCQV-ASGHIPCMVNGSSKETCQQAGCCYDST--KEEPCYYGNTV 268
Cdd:smart00018   1 AQCSVpPSERINCGPPGITEAECEARGCCFDSSisGVPWCFYPNTV 46
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
271-541 8.61e-71

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 229.20  E-value: 8.61e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   271 QCFkSGYFTLVMSQETALTHGVLLDNVHLAyaPNGCPP--TQKTSAFVVFHVPLTLCGTAIQVVGEQLIYENQLVsdidV 348
Cdd:smart00241   1 QCG-EDQMVVSVSTDLLFPGGINVKGLTLG--DPSCRPqfTDATSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLV----V 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   349 QKGPQGSITRDSAFRLHVRCIFNASDFLPIQASIFS-PQPPAPVTQSGPLRLELRIATDKTFSSYYQGSDYPLvrllREP 427
Cdd:smart00241  74 SPFHPGFITRDDRAAYHFQCFYPENEKVSLNLDVSTiPPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYVL----GDP 149
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   428 VYVEVRLLQRTDPSLVLVLHQCWATPTTSPFEQPQWPILSDGCPFkgDNYRTQVVAADREalpfWSHYQRFTITTFMLLD 507
Cdd:smart00241 150 VYHEWECDGADDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPV--DGYLDSTIPYNSN----PLHRARFSVKVFKFAD 223
                          250       260       270
                   ....*....|....*....|....*....|....*
gi 124249092   508 sssqnalRGQVYFFCSASACHPLGSDTCST-TCDS 541
Cdd:smart00241 224 -------RSLVYFHCQIRLCDKDDGSSCDGpACSS 251
Zona_pellucida pfam00100
Zona pellucida-like domain;
272-539 3.66e-57

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 192.84  E-value: 3.66e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092  272 CFKSgYFTLVMSQETALTHGvLLDNVHLAYAPN-GCPPTQKTsafVVFHVPLTLCGTAIQVVGEQLIYENQLVSDIDVQk 350
Cdd:pfam00100   1 CTVD-TIVSSISQNPTLPSL-LLDEVSLLGGDDaTCSPVGAT---VIFEFPSTACGTVFQVIGTVKIYSNRLYASTDVG- 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092  351 GPQGSITRDsaFRLHVRCIFNASDFLpiqasifspqppAPVTQSGPLRLELRIATDKTFSSYYQgsDYPLVRLLREPVYV 430
Cdd:pfam00100  75 WITRSITRK--LRVYFRASYDSSSAV------------NVGSGSGVLLMSLDLYKSESYSVYYV--PYPVTKLLRQPVYV 138
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092  431 EVRLLQRTDPSLVLVLHQCWATPTTSPFEQPQ-WPILSDGCPFKGD-NYRTQVVAADREALPFWSHYQRFTITTFMLLDS 508
Cdd:pfam00100 139 EVELLSRTDPNLNLLLDLCWATPSANPTSDIIwWDICVDGCDNTDDsYYSPRLPVTVTSVNNYPSHYKRFFFFMFTFVDD 218
                         250       260       270
                  ....*....|....*....|....*....|.
gi 124249092  509 SsqNALRGQVYFFCSASACHPlGSDTCSTTC 539
Cdd:pfam00100 219 T--DALSGQVYLHCSASQCSS-NSNCCADSC 246
PD smart00018
P or trefoil or TFF domain; Proposed role in renewal and pathology of mucous epithelia.
226-268 2.76e-10

P or trefoil or TFF domain; Proposed role in renewal and pathology of mucous epithelia.


Pssm-ID: 197472  Cd Length: 46  Bit Score: 55.85  E-value: 2.76e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 124249092   226 ERCQV-ASGHIPCMVNGSSKETCQQAGCCYDST--KEEPCYYGNTV 268
Cdd:smart00018   1 AQCSVpPSERINCGPPGITEAECEARGCCFDSSisGVPWCFYPNTV 46
Trefoil cd00111
P or trefoil or TFF domain; Trefoil factor family domain peptides are mucin-associated ...
226-266 1.22e-08

P or trefoil or TFF domain; Trefoil factor family domain peptides are mucin-associated molecules, largely found in epithelia of gastrointestinal tissues. Function is not known but it was originally identified from mucosal tissues, where it may have a regulatory or structural role and has also been implicated as a growth fractor in other tissues.The domain is found in 1 to 6 copies where it occurs.


Pssm-ID: 238059  Cd Length: 44  Bit Score: 51.19  E-value: 1.22e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 124249092 226 ERCQV-ASGHIPCMVNGSSKETCQQAGCCYDST--KEEPCYYGN 266
Cdd:cd00111    1 EWCSVpPSERIDCGPPGITQEECEARGCCFDPSisGVPWCFYPK 44
Trefoil pfam00088
Trefoil (P-type) domain;
235-265 1.55e-03

Trefoil (P-type) domain;


Pssm-ID: 395041  Cd Length: 43  Bit Score: 36.52  E-value: 1.55e-03
                          10        20        30
                  ....*....|....*....|....*....|....
gi 124249092  235 IPCMVNGSSKETCQQAGCCYDSTKEE---PCYYG 265
Cdd:pfam00088  10 FDCGYPGITQEECEARGCCWDPSVDPgvpWCFYP 43
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
271-541 8.61e-71

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 229.20  E-value: 8.61e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   271 QCFkSGYFTLVMSQETALTHGVLLDNVHLAyaPNGCPP--TQKTSAFVVFHVPLTLCGTAIQVVGEQLIYENQLVsdidV 348
Cdd:smart00241   1 QCG-EDQMVVSVSTDLLFPGGINVKGLTLG--DPSCRPqfTDATSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLV----V 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   349 QKGPQGSITRDSAFRLHVRCIFNASDFLPIQASIFS-PQPPAPVTQSGPLRLELRIATDKTFSSYYQGSDYPLvrllREP 427
Cdd:smart00241  74 SPFHPGFITRDDRAAYHFQCFYPENEKVSLNLDVSTiPPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYVL----GDP 149
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092   428 VYVEVRLLQRTDPSLVLVLHQCWATPTTSPFEQPQWPILSDGCPFkgDNYRTQVVAADREalpfWSHYQRFTITTFMLLD 507
Cdd:smart00241 150 VYHEWECDGADDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPV--DGYLDSTIPYNSN----PLHRARFSVKVFKFAD 223
                          250       260       270
                   ....*....|....*....|....*....|....*
gi 124249092   508 sssqnalRGQVYFFCSASACHPLGSDTCST-TCDS 541
Cdd:smart00241 224 -------RSLVYFHCQIRLCDKDDGSSCDGpACSS 251
Zona_pellucida pfam00100
Zona pellucida-like domain;
272-539 3.66e-57

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 192.84  E-value: 3.66e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092  272 CFKSgYFTLVMSQETALTHGvLLDNVHLAYAPN-GCPPTQKTsafVVFHVPLTLCGTAIQVVGEQLIYENQLVSDIDVQk 350
Cdd:pfam00100   1 CTVD-TIVSSISQNPTLPSL-LLDEVSLLGGDDaTCSPVGAT---VIFEFPSTACGTVFQVIGTVKIYSNRLYASTDVG- 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092  351 GPQGSITRDsaFRLHVRCIFNASDFLpiqasifspqppAPVTQSGPLRLELRIATDKTFSSYYQgsDYPLVRLLREPVYV 430
Cdd:pfam00100  75 WITRSITRK--LRVYFRASYDSSSAV------------NVGSGSGVLLMSLDLYKSESYSVYYV--PYPVTKLLRQPVYV 138
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124249092  431 EVRLLQRTDPSLVLVLHQCWATPTTSPFEQPQ-WPILSDGCPFKGD-NYRTQVVAADREALPFWSHYQRFTITTFMLLDS 508
Cdd:pfam00100 139 EVELLSRTDPNLNLLLDLCWATPSANPTSDIIwWDICVDGCDNTDDsYYSPRLPVTVTSVNNYPSHYKRFFFFMFTFVDD 218
                         250       260       270
                  ....*....|....*....|....*....|.
gi 124249092  509 SsqNALRGQVYFFCSASACHPlGSDTCSTTC 539
Cdd:pfam00100 219 T--DALSGQVYLHCSASQCSS-NSNCCADSC 246
PD smart00018
P or trefoil or TFF domain; Proposed role in renewal and pathology of mucous epithelia.
226-268 2.76e-10

P or trefoil or TFF domain; Proposed role in renewal and pathology of mucous epithelia.


Pssm-ID: 197472  Cd Length: 46  Bit Score: 55.85  E-value: 2.76e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 124249092   226 ERCQV-ASGHIPCMVNGSSKETCQQAGCCYDST--KEEPCYYGNTV 268
Cdd:smart00018   1 AQCSVpPSERINCGPPGITEAECEARGCCFDSSisGVPWCFYPNTV 46
Trefoil cd00111
P or trefoil or TFF domain; Trefoil factor family domain peptides are mucin-associated ...
226-266 1.22e-08

P or trefoil or TFF domain; Trefoil factor family domain peptides are mucin-associated molecules, largely found in epithelia of gastrointestinal tissues. Function is not known but it was originally identified from mucosal tissues, where it may have a regulatory or structural role and has also been implicated as a growth fractor in other tissues.The domain is found in 1 to 6 copies where it occurs.


Pssm-ID: 238059  Cd Length: 44  Bit Score: 51.19  E-value: 1.22e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 124249092 226 ERCQV-ASGHIPCMVNGSSKETCQQAGCCYDST--KEEPCYYGN 266
Cdd:cd00111    1 EWCSVpPSERIDCGPPGITQEECEARGCCFDPSisGVPWCFYPK 44
Trefoil pfam00088
Trefoil (P-type) domain;
235-265 1.55e-03

Trefoil (P-type) domain;


Pssm-ID: 395041  Cd Length: 43  Bit Score: 36.52  E-value: 1.55e-03
                          10        20        30
                  ....*....|....*....|....*....|....
gi 124249092  235 IPCMVNGSSKETCQQAGCCYDSTKEE---PCYYG 265
Cdd:pfam00088  10 FDCGYPGITQEECEARGCCWDPSVDPgvpWCFYP 43
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH