NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6753594|ref|NP_034646|]
View 

CCN family member 1 precursor [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TSP1_CCN pfam19035
CCN3 Nov like TSP1 domain; This entry represents a sub-type of TSP1 domains found in ...
227-270 1.37e-18

CCN3 Nov like TSP1 domain; This entry represents a sub-type of TSP1 domains found in matricellular CCN proteins that have an alternative disulphide binding pattern compared to the canonical TSP1 domains.


:

Pssm-ID: 408805  Cd Length: 44  Bit Score: 78.47  E-value: 1.37e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 6753594    227 CIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPC 270
Cdd:pfam19035   1 CKPQTTEWSPCSKTCGLGVSTRVSNDNAECKLEKETRLCQIRPC 44
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
291-373 5.21e-15

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerization.


:

Pssm-ID: 394966  Cd Length: 105  Bit Score: 70.13  E-value: 5.21e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6753594    291 PEPVRFTYAGCSSVKKYRPKYC-GSCV-------DGR-------CCTPLQTRTVKMRFRCEDGEMFSKNVMMIQSCKCNy 355
Cdd:pfam00007   8 NYTISVEKEGCTSCKTINTTICaGYCYtrdpvykDGRravsqrvCTYRDVTYETVVLPGCPPGVDPTVTYPVALSCHCG- 86
                          90
                  ....*....|....*...
gi 6753594    356 NCPHPNEASFRLYSLFND 373
Cdd:pfam00007  87 NCPTDNSDCTRLSLQPDS 104
IGFBP pfam00219
Insulin-like growth factor binding protein;
26-78 4.43e-10

Insulin-like growth factor binding protein;


:

Pssm-ID: 395164  Cd Length: 53  Bit Score: 54.62  E-value: 4.43e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 6753594     26 CPAAC---HCPLEAPKCAPGVglVRDGCGCCKVCAKQLNEDCS-KTQPCDhtKGLEC 78
Cdd:pfam00219   1 CPPPCdpeRCPPPPPGCPAGV--VLDGCGCCKVCARQEGEPCGvYTGPCG--KGLRC 53
VWC smart00214
von Willebrand factor (vWF) type C domain;
100-159 1.72e-08

von Willebrand factor (vWF) type C domain;


:

Pssm-ID: 214564  Cd Length: 59  Bit Score: 50.59  E-value: 1.72e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6753594     100 CEYNSRIYQNGESFQPNCKHQCTCIDGA-VGCIPL-CPqelslPNLGCPNPRLVKVSGQCCE 159
Cdd:smart00214   1 CVHNGRVYNDGETWKPDPCQICTCLDGTtVLCDPVeCP-----PPPDCPNPERVKPPGECCP 57
 
Name Accession Description Interval E-value
TSP1_CCN pfam19035
CCN3 Nov like TSP1 domain; This entry represents a sub-type of TSP1 domains found in ...
227-270 1.37e-18

CCN3 Nov like TSP1 domain; This entry represents a sub-type of TSP1 domains found in matricellular CCN proteins that have an alternative disulphide binding pattern compared to the canonical TSP1 domains.


Pssm-ID: 408805  Cd Length: 44  Bit Score: 78.47  E-value: 1.37e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 6753594    227 CIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPC 270
Cdd:pfam19035   1 CKPQTTEWSPCSKTCGLGVSTRVSNDNAECKLEKETRLCQIRPC 44
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
291-373 5.21e-15

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerization.


Pssm-ID: 394966  Cd Length: 105  Bit Score: 70.13  E-value: 5.21e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6753594    291 PEPVRFTYAGCSSVKKYRPKYC-GSCV-------DGR-------CCTPLQTRTVKMRFRCEDGEMFSKNVMMIQSCKCNy 355
Cdd:pfam00007   8 NYTISVEKEGCTSCKTINTTICaGYCYtrdpvykDGRravsqrvCTYRDVTYETVVLPGCPPGVDPTVTYPVALSCHCG- 86
                          90
                  ....*....|....*...
gi 6753594    356 NCPHPNEASFRLYSLFND 373
Cdd:pfam00007  87 NCPTDNSDCTRLSLQPDS 104
CT smart00041
C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta ...
290-358 1.31e-10

C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.


Pssm-ID: 214482  Cd Length: 82  Bit Score: 57.03  E-value: 1.31e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6753594     290 SPEPVRFTYAGCSSVKkYRPKYC-GSCVD------------GRCCTPLQTRTVKMRFRCEDGEMFSKNVMMIQSCKCNYN 356
Cdd:smart00041   2 SPVRQTITYNGCTSVT-VKNAFCeGKCGSassysiqdvqhsCSCCQPHKTKTRQVRLRCPDGSTVKKTVMHIEECGCEPN 80

                   ..
gi 6753594     357 CP 358
Cdd:smart00041  81 CP 82
IGFBP pfam00219
Insulin-like growth factor binding protein;
26-78 4.43e-10

Insulin-like growth factor binding protein;


Pssm-ID: 395164  Cd Length: 53  Bit Score: 54.62  E-value: 4.43e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 6753594     26 CPAAC---HCPLEAPKCAPGVglVRDGCGCCKVCAKQLNEDCS-KTQPCDhtKGLEC 78
Cdd:pfam00219   1 CPPPCdpeRCPPPPPGCPAGV--VLDGCGCCKVCARQEGEPCGvYTGPCG--KGLRC 53
VWC smart00214
von Willebrand factor (vWF) type C domain;
100-159 1.72e-08

von Willebrand factor (vWF) type C domain;


Pssm-ID: 214564  Cd Length: 59  Bit Score: 50.59  E-value: 1.72e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6753594     100 CEYNSRIYQNGESFQPNCKHQCTCIDGA-VGCIPL-CPqelslPNLGCPNPRLVKVSGQCCE 159
Cdd:smart00214   1 CVHNGRVYNDGETWKPDPCQICTCLDGTtVLCDPVeCP-----PPPDCPNPERVKPPGECCP 57
IB smart00121
Insulin growth factor-binding protein homologues; High affinity binding partners of ...
32-84 2.09e-07

Insulin growth factor-binding protein homologues; High affinity binding partners of insulin-like growth factors.


Pssm-ID: 197525  Cd Length: 75  Bit Score: 47.85  E-value: 2.09e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 6753594      32 CPLEAPKCApgVGLVRDGCGCCKVCAKQLNEDCSK-TQPCdhTKGLECNFGASS 84
Cdd:smart00121  11 CPPCPPGCA--ELVRLDGCGCCPVCARQEGEPCGVyTPRC--APGLRCQPPPGE 60
VWC pfam00093
von Willebrand factor type C domain; The high cutoff was used to prevent overlap with ...
100-160 2.10e-07

von Willebrand factor type C domain; The high cutoff was used to prevent overlap with pfam00094.


Pssm-ID: 278520  Cd Length: 57  Bit Score: 47.42  E-value: 2.10e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6753594    100 CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPlcpqeLSLPNLGCPNPRLVKVSGQCCEE 160
Cdd:pfam00093   1 CVQNGVVYENGETWKPDLCTICTCDDGKVLCDK-----IICPPLDCPNPRLEIPPGECCPV 56
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
230-270 2.79e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 35.64  E-value: 2.79e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 6753594     230 QTTSWSQCSKSCGTGISTRV--------TNDNPECR-LVKETRICEVRPC 270
Cdd:smart00209   3 EWSEWSPCSVTCGGGVQTRTrsccspppQNGGGPCTgEDVETRACNEQPC 52
 
Name Accession Description Interval E-value
TSP1_CCN pfam19035
CCN3 Nov like TSP1 domain; This entry represents a sub-type of TSP1 domains found in ...
227-270 1.37e-18

CCN3 Nov like TSP1 domain; This entry represents a sub-type of TSP1 domains found in matricellular CCN proteins that have an alternative disulphide binding pattern compared to the canonical TSP1 domains.


Pssm-ID: 408805  Cd Length: 44  Bit Score: 78.47  E-value: 1.37e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 6753594    227 CIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPC 270
Cdd:pfam19035   1 CKPQTTEWSPCSKTCGLGVSTRVSNDNAECKLEKETRLCQIRPC 44
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
291-373 5.21e-15

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerization.


Pssm-ID: 394966  Cd Length: 105  Bit Score: 70.13  E-value: 5.21e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6753594    291 PEPVRFTYAGCSSVKKYRPKYC-GSCV-------DGR-------CCTPLQTRTVKMRFRCEDGEMFSKNVMMIQSCKCNy 355
Cdd:pfam00007   8 NYTISVEKEGCTSCKTINTTICaGYCYtrdpvykDGRravsqrvCTYRDVTYETVVLPGCPPGVDPTVTYPVALSCHCG- 86
                          90
                  ....*....|....*...
gi 6753594    356 NCPHPNEASFRLYSLFND 373
Cdd:pfam00007  87 NCPTDNSDCTRLSLQPDS 104
CT smart00041
C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta ...
290-358 1.31e-10

C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.


Pssm-ID: 214482  Cd Length: 82  Bit Score: 57.03  E-value: 1.31e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6753594     290 SPEPVRFTYAGCSSVKkYRPKYC-GSCVD------------GRCCTPLQTRTVKMRFRCEDGEMFSKNVMMIQSCKCNYN 356
Cdd:smart00041   2 SPVRQTITYNGCTSVT-VKNAFCeGKCGSassysiqdvqhsCSCCQPHKTKTRQVRLRCPDGSTVKKTVMHIEECGCEPN 80

                   ..
gi 6753594     357 CP 358
Cdd:smart00041  81 CP 82
IGFBP pfam00219
Insulin-like growth factor binding protein;
26-78 4.43e-10

Insulin-like growth factor binding protein;


Pssm-ID: 395164  Cd Length: 53  Bit Score: 54.62  E-value: 4.43e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 6753594     26 CPAAC---HCPLEAPKCAPGVglVRDGCGCCKVCAKQLNEDCS-KTQPCDhtKGLEC 78
Cdd:pfam00219   1 CPPPCdpeRCPPPPPGCPAGV--VLDGCGCCKVCARQEGEPCGvYTGPCG--KGLRC 53
VWC smart00214
von Willebrand factor (vWF) type C domain;
100-159 1.72e-08

von Willebrand factor (vWF) type C domain;


Pssm-ID: 214564  Cd Length: 59  Bit Score: 50.59  E-value: 1.72e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6753594     100 CEYNSRIYQNGESFQPNCKHQCTCIDGA-VGCIPL-CPqelslPNLGCPNPRLVKVSGQCCE 159
Cdd:smart00214   1 CVHNGRVYNDGETWKPDPCQICTCLDGTtVLCDPVeCP-----PPPDCPNPERVKPPGECCP 57
IB smart00121
Insulin growth factor-binding protein homologues; High affinity binding partners of ...
32-84 2.09e-07

Insulin growth factor-binding protein homologues; High affinity binding partners of insulin-like growth factors.


Pssm-ID: 197525  Cd Length: 75  Bit Score: 47.85  E-value: 2.09e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 6753594      32 CPLEAPKCApgVGLVRDGCGCCKVCAKQLNEDCSK-TQPCdhTKGLECNFGASS 84
Cdd:smart00121  11 CPPCPPGCA--ELVRLDGCGCCPVCARQEGEPCGVyTPRC--APGLRCQPPPGE 60
VWC pfam00093
von Willebrand factor type C domain; The high cutoff was used to prevent overlap with ...
100-160 2.10e-07

von Willebrand factor type C domain; The high cutoff was used to prevent overlap with pfam00094.


Pssm-ID: 278520  Cd Length: 57  Bit Score: 47.42  E-value: 2.10e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6753594    100 CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPlcpqeLSLPNLGCPNPRLVKVSGQCCEE 160
Cdd:pfam00093   1 CVQNGVVYENGETWKPDLCTICTCDDGKVLCDK-----IICPPLDCPNPRLEIPPGECCPV 56
TSP1_spondin pfam19028
Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an ...
232-270 1.64e-03

Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an alternative disulphide binding pattern compared to the canonical TSP1 domain.


Pssm-ID: 408798  Cd Length: 52  Bit Score: 36.09  E-value: 1.64e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 6753594    232 TSWSQCSKSCGTGISTRV-------TNDNPECRLVKETRICEVRPC 270
Cdd:pfam19028   7 SEWSECSKTCGGGVQTRTrtvivepQNGGRPCPELLERRPCNGPPC 52
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
230-270 2.79e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 35.64  E-value: 2.79e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 6753594     230 QTTSWSQCSKSCGTGISTRV--------TNDNPECR-LVKETRICEVRPC 270
Cdd:smart00209   3 EWSEWSPCSVTCGGGVQTRTrsccspppQNGGGPCTgEDVETRACNEQPC 52
TSP1_ADAMTS pfam19030
Thrombospondin type 1 domain; This subfamily of thrombospondin type 1 repeats are mainly found ...
231-270 4.19e-03

Thrombospondin type 1 domain; This subfamily of thrombospondin type 1 repeats are mainly found in ADAMTS proteins.


Pssm-ID: 408800  Cd Length: 55  Bit Score: 35.12  E-value: 4.19e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 6753594    231 TTSWSQCSKSCGTGISTRV----------TNDNPECRLVK---ETRICEVRPC 270
Cdd:pfam19030   3 AGPWGECSVTCGGGVQTRLvqcvqklggsLVPDSQCSAQKkppETQSCNLKPC 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH