NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|119120881|ref|NP_035522|]
View 

sodium-dependent phosphate transport protein 2A [Mus musculus]

Protein Classification

sodium-dependent phosphate transport protein 2 (domain architecture ID 11490082)

sodium-dependent phosphate transport protein 2 may be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-588 0e+00

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 534.44  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  108 LAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIRGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  268 KVITEPFTRLIIQLDKSVITSIAvgdeSLRNHSLIRIWCHPDTteastSMSRVEAigslaNTTMEkcNHIFVDtglpdla 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTLS-----SLPVPES-----NLPIE--AHIFVN------- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  348 VGLILLAGSLVVLCTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAITPL 427
Cdd:TIGR01013 218 VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALTPL 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  428 IGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNISGILLWYPLPCTRLPIRMAKALGKRTA 507
Cdd:TIGR01013 298 VGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDDGS 377
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  508 KYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQSRSPGhlPKWLQTWDFLPRWMHSLQPL 587
Cdd:TIGR01013 378 KYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLKRL 455

                  .
gi 119120881  588 D 588
Cdd:TIGR01013 456 D 456
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-588 0e+00

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 534.44  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  108 LAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIRGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  268 KVITEPFTRLIIQLDKSVITSIAvgdeSLRNHSLIRIWCHPDTteastSMSRVEAigslaNTTMEkcNHIFVDtglpdla 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTLS-----SLPVPES-----NLPIE--AHIFVN------- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  348 VGLILLAGSLVVLCTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAITPL 427
Cdd:TIGR01013 218 VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALTPL 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  428 IGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNISGILLWYPLPCTRLPIRMAKALGKRTA 507
Cdd:TIGR01013 298 VGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDDGS 377
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  508 KYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQSRSPGhlPKWLQTWDFLPRWMHSLQPL 587
Cdd:TIGR01013 378 KYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLKRL 455

                  .
gi 119120881  588 D 588
Cdd:TIGR01013 456 D 456
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-496 1.65e-17

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 85.76  E-value: 1.65e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 106 LMLAFLYLFVCSLDVLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283    9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLVLLPleaatgylhhvtglvvasfnirggrdapd 265
Cdd:COG1283   87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKLRQLG----------------------------- 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 266 llkvitepftRLIIqldksvitsiavgdeslrnhsliriwchpdtteastsmsrveaigslanttmekcnhifvdtglpd 345
Cdd:COG1283  135 ----------RVLF------------------------------------------------------------------ 138
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 346 lAVGLILLAGSLVVlctclillvkmlNSLLKGQVANVIQKVINTDFPAPFTwvtgyfAMVVGASMTFVVQSSSVFTSAIT 425
Cdd:COG1283  139 -GIGLIFLSLELLG------------QATEPLRQSPAFSDFIAKLSDDPIV------ALLIGALLTALIQSSLAAIGILL 199
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 119120881 426 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLsssfQIALCHFFFNISG---ILLWYPLPCTRLPI 496
Cdd:COG1283  200 SLTSQGLISLEAALALVLGANLGTTITAVLAALGASAAAR----RVALGNLLFNLIGvliFLPVIHLLATFASK 269
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 1.92e-15

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 73.20  E-value: 1.92e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  113 LFVCSLDVLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 119120881  191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
401-489 5.01e-10

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 61.08  E-value: 5.01e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 401 YFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPRE-KLSssfqiALCHFFFN 479
Cdd:NF037997 165 LLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASIGSGKEaKLT-----AYAHIWLN 239
                         90
                 ....*....|
gi 119120881 480 ISGILLWYPL 489
Cdd:NF037997 240 VLGVLLFLPF 249
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 4.62e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 45.67  E-value: 4.62e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997 163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                         90
                 ....*....|...
gi 119120881 225 CFNWLSVLVLLPL 237
Cdd:NF037997 237 WLNVLGVLLFLPF 249
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-588 0e+00

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 534.44  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  108 LAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIRGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  268 KVITEPFTRLIIQLDKSVITSIAvgdeSLRNHSLIRIWCHPDTteastSMSRVEAigslaNTTMEkcNHIFVDtglpdla 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTLS-----SLPVPES-----NLPIE--AHIFVN------- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  348 VGLILLAGSLVVLCTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAITPL 427
Cdd:TIGR01013 218 VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALTPL 297
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  428 IGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNISGILLWYPLPCTRLPIRMAKALGKRTA 507
Cdd:TIGR01013 298 VGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDDGS 377
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  508 KYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQSRSPGhlPKWLQTWDFLPRWMHSLQPL 587
Cdd:TIGR01013 378 KYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLKRL 455

                  .
gi 119120881  588 D 588
Cdd:TIGR01013 456 D 456
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-496 1.65e-17

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 85.76  E-value: 1.65e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 106 LMLAFLYLFVCSLDVLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283    9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLVLLPleaatgylhhvtglvvasfnirggrdapd 265
Cdd:COG1283   87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKLRQLG----------------------------- 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 266 llkvitepftRLIIqldksvitsiavgdeslrnhsliriwchpdtteastsmsrveaigslanttmekcnhifvdtglpd 345
Cdd:COG1283  135 ----------RVLF------------------------------------------------------------------ 138
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 346 lAVGLILLAGSLVVlctclillvkmlNSLLKGQVANVIQKVINTDFPAPFTwvtgyfAMVVGASMTFVVQSSSVFTSAIT 425
Cdd:COG1283  139 -GIGLIFLSLELLG------------QATEPLRQSPAFSDFIAKLSDDPIV------ALLIGALLTALIQSSLAAIGILL 199
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 119120881 426 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLsssfQIALCHFFFNISG---ILLWYPLPCTRLPI 496
Cdd:COG1283  200 SLTSQGLISLEAALALVLGANLGTTITAVLAALGASAAAR----RVALGNLLFNLIGvliFLPVIHLLATFASK 269
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 1.92e-15

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 73.20  E-value: 1.92e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881  113 LFVCSLDVLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 119120881  191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
401-489 5.01e-10

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 61.08  E-value: 5.01e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 401 YFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPRE-KLSssfqiALCHFFFN 479
Cdd:NF037997 165 LLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASIGSGKEaKLT-----AYAHIWLN 239
                         90
                 ....*....|
gi 119120881 480 ISGILLWYPL 489
Cdd:NF037997 240 VLGVLLFLPF 249
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
403-458 2.09e-09

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 55.87  E-value: 2.09e-09
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 119120881  403 AMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAAL 458
Cdd:pfam02690  35 GLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMGANIGTTVTAQLIAF 90
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
346-484 9.68e-07

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 51.87  E-value: 9.68e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 346 LAVGLILLAGSLVVLctclILLVKMLNSLLKGQVANVIQKVINTDFPAPFtwvtgyFAMVVGASMTFVVQSSSVFTSAIT 425
Cdd:COG1283    3 KQLVLLNLLGAVALL----LFGIKMVGDGVQRAAGDRLRKILARFTSNPI------LGVLAGIVATALLQSSTATTVLTI 72
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 119120881 426 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALaspreKLSS----SFQIALCHFFFNISGIL 484
Cdd:COG1283   73 GFVAAGLLSLKQAIGVILGANIGTTVTAWIVAL-----DLSWlsppLLAIGAILFFFGKSSKL 130
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 4.62e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 45.67  E-value: 4.62e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119120881 145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997 163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                         90
                 ....*....|...
gi 119120881 225 CFNWLSVLVLLPL 237
Cdd:NF037997 237 WLNVLGVLLFLPF 249
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH