NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|9625942|ref|NP_040190|]
View 

envelope glycoprotein E [Human alphaherpesvirus 3]

Protein Classification

PHA03281 family protein( domain architecture ID 10010507)

PHA03281 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03281 PHA03281
envelope glycoprotein E; Provisional
1-621 0e+00

envelope glycoprotein E; Provisional


:

Pssm-ID: 165538  Cd Length: 642  Bit Score: 1234.57  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942     1 MGTVNKPVVGVLMG---FGIITGTLRITNPVRASVLRYDDFHTDEDKLDTNSVYEPYYHSDHAESSWVNRGESSRKAYDH 77
Cdd:PHA03281   1 MGTVKHPMLGLICGtlsFGIIIGTLAIANAIKAEVLRYDDFDMDEDGLDGDDIYEPYYHSDHAESSWVNRGDSINAAYDH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    78 NSPYIWPRNDY------DGFLENAHEHHGVYNQGRGIDSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQ 151
Cdd:PHA03281  81 ERPFIQDKNDHkmetytDGFLENAHEHDGQINQERGIDSGERLMQPTNMIAAEDLGDDNGEHVDLTLNGDDKHKIMKHDH 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   152 RQYGD---VFKG--DLNPKPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTTC 226
Cdd:PHA03281 161 RNFGDasiLFKGvhDINHKHAGQRLIEVSVAENHPFLLKAHIPQENEHRYTERWSFLPAAPCKGDAAPAIQHICIKHGAC 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   227 FQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGS 306
Cdd:PHA03281 241 FHDVVVDVDCAAESKEDQLAEIGYRFHAKKAADPPWIVVNISEDFAELEFDPPDIEPGVLKFEHMEAHHAGVYIWNLQGS 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   307 DGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPT 386
Cdd:PHA03281 321 DGENMYATFLVKLKGDEENHIDLPAVTPKPKGAEFHMWHYHSHVFSVGDTFSLAMHLQYKIHDAPFDLLLEWLYVPIDPT 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   387 CQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDGGTTLKFV 466
Cdd:PHA03281 401 CQPMRLYSACLYHENAPQCLSHENPECTFASPHIAQRVANTVYQNCEHADNYTADCLAISHMEPGFGLEIHDGGSALKFV 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   467 DTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVN----PGTSPLLRYAAWT 542
Cdd:PHA03281 481 DAAESLSGLYVFIIHFNGHVEAVAYTVVSTIDHFVNAIEEHGFPPEAGNPPAPSKPKEIANNDvisePGTFPFKRYAAIT 560
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 9625942   543 GGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDK 621
Cdd:PHA03281 561 GGFAALALLCLAIALICTAKKFGHKAYRSDKAAYGQSMYYAGLPVDDFEDDEETDTDEEFGNAIGAECGGSGYTVYIDK 639
 
Name Accession Description Interval E-value
PHA03281 PHA03281
envelope glycoprotein E; Provisional
1-621 0e+00

envelope glycoprotein E; Provisional


Pssm-ID: 165538  Cd Length: 642  Bit Score: 1234.57  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942     1 MGTVNKPVVGVLMG---FGIITGTLRITNPVRASVLRYDDFHTDEDKLDTNSVYEPYYHSDHAESSWVNRGESSRKAYDH 77
Cdd:PHA03281   1 MGTVKHPMLGLICGtlsFGIIIGTLAIANAIKAEVLRYDDFDMDEDGLDGDDIYEPYYHSDHAESSWVNRGDSINAAYDH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    78 NSPYIWPRNDY------DGFLENAHEHHGVYNQGRGIDSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQ 151
Cdd:PHA03281  81 ERPFIQDKNDHkmetytDGFLENAHEHDGQINQERGIDSGERLMQPTNMIAAEDLGDDNGEHVDLTLNGDDKHKIMKHDH 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   152 RQYGD---VFKG--DLNPKPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTTC 226
Cdd:PHA03281 161 RNFGDasiLFKGvhDINHKHAGQRLIEVSVAENHPFLLKAHIPQENEHRYTERWSFLPAAPCKGDAAPAIQHICIKHGAC 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   227 FQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGS 306
Cdd:PHA03281 241 FHDVVVDVDCAAESKEDQLAEIGYRFHAKKAADPPWIVVNISEDFAELEFDPPDIEPGVLKFEHMEAHHAGVYIWNLQGS 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   307 DGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPT 386
Cdd:PHA03281 321 DGENMYATFLVKLKGDEENHIDLPAVTPKPKGAEFHMWHYHSHVFSVGDTFSLAMHLQYKIHDAPFDLLLEWLYVPIDPT 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   387 CQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDGGTTLKFV 466
Cdd:PHA03281 401 CQPMRLYSACLYHENAPQCLSHENPECTFASPHIAQRVANTVYQNCEHADNYTADCLAISHMEPGFGLEIHDGGSALKFV 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   467 DTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVN----PGTSPLLRYAAWT 542
Cdd:PHA03281 481 DAAESLSGLYVFIIHFNGHVEAVAYTVVSTIDHFVNAIEEHGFPPEAGNPPAPSKPKEIANNDvisePGTFPFKRYAAIT 560
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 9625942   543 GGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDK 621
Cdd:PHA03281 561 GGFAALALLCLAIALICTAKKFGHKAYRSDKAAYGQSMYYAGLPVDDFEDDEETDTDEEFGNAIGAECGGSGYTVYIDK 639
Herpes_gE pfam02480
Alphaherpesvirus glycoprotein E; Glycoprotein E (gE) of Alphaherpesvirus forms a complex with ...
193-616 0e+00

Alphaherpesvirus glycoprotein E; Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI) (pfam01688), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation.


Pssm-ID: 280617  Cd Length: 432  Bit Score: 606.09  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    193 GVRYTETWSFLPSLTCtgdaAPAIQHICLKHTTCFQDVVVDVDCAENTKEDQL--AEISYRFQGKKEADQPWIVVNTSTL 270
Cdd:pfam02480   5 GGPYTETWVWLPSPCC----APATGYICLESAHCFTDLVVDVACARYAMRAPLptAEAYVPPGPAKQIGLLSLNGVPNIL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    271 FDELELDPpeiepGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKT-RNPTPA---VTPQPRGAEFHMWNY 346
Cdd:pfam02480  81 RDRVAVVN-----GSLVILGASKQNSGLYILSVRGSTDTATQVAVVVLVVGPAPDpRLPTPRaspEVSSVRGVTVHMENP 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    347 HSHVFSVGDTFSLAMHLQYKIHE-APFDLLLEWLYVPIDPTCQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVA 425
Cdd:pfam02480 156 EAHVFSPGDTFSLNVSIIAIAHDdEPYTLDVEWLRVPYDPTCAFMRIYEACLYHPQAPECLSPADSGCAFSSNIWALRVA 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    426 STVYQNCEHADnYTAYCLGISHMEPSFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIE 505
Cdd:pfam02480 236 VRSYANCSRTD-PPRRCIAEAHMEPSPGLALTAGIPNLKFKDASPQHSGLYVCVVYVNDHVHAWAYTTLSTVAQYRNAVE 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    506 ERGFPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGL 585
Cdd:pfam02480 315 EQHLPQRDEDPAEPTSPHEIAPPNNGTIRGALLLAAVSGAALLLVLLGLSAWACMTKRRRRRWRRVKSRLSDEGPTYIRL 394
                         410       420       430
                  ....*....|....*....|....*....|....*...
gi 9625942    586 PVDDF-----EDSESTDTEEEFGNAI--GGSHGGSSYT 616
Cdd:pfam02480 395 PVSDLyadwsEDSEGERDEVEYYQEPedSPSTNGSGYE 432
 
Name Accession Description Interval E-value
PHA03281 PHA03281
envelope glycoprotein E; Provisional
1-621 0e+00

envelope glycoprotein E; Provisional


Pssm-ID: 165538  Cd Length: 642  Bit Score: 1234.57  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942     1 MGTVNKPVVGVLMG---FGIITGTLRITNPVRASVLRYDDFHTDEDKLDTNSVYEPYYHSDHAESSWVNRGESSRKAYDH 77
Cdd:PHA03281   1 MGTVKHPMLGLICGtlsFGIIIGTLAIANAIKAEVLRYDDFDMDEDGLDGDDIYEPYYHSDHAESSWVNRGDSINAAYDH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    78 NSPYIWPRNDY------DGFLENAHEHHGVYNQGRGIDSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQ 151
Cdd:PHA03281  81 ERPFIQDKNDHkmetytDGFLENAHEHDGQINQERGIDSGERLMQPTNMIAAEDLGDDNGEHVDLTLNGDDKHKIMKHDH 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   152 RQYGD---VFKG--DLNPKPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTTC 226
Cdd:PHA03281 161 RNFGDasiLFKGvhDINHKHAGQRLIEVSVAENHPFLLKAHIPQENEHRYTERWSFLPAAPCKGDAAPAIQHICIKHGAC 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   227 FQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGS 306
Cdd:PHA03281 241 FHDVVVDVDCAAESKEDQLAEIGYRFHAKKAADPPWIVVNISEDFAELEFDPPDIEPGVLKFEHMEAHHAGVYIWNLQGS 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   307 DGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPT 386
Cdd:PHA03281 321 DGENMYATFLVKLKGDEENHIDLPAVTPKPKGAEFHMWHYHSHVFSVGDTFSLAMHLQYKIHDAPFDLLLEWLYVPIDPT 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   387 CQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDGGTTLKFV 466
Cdd:PHA03281 401 CQPMRLYSACLYHENAPQCLSHENPECTFASPHIAQRVANTVYQNCEHADNYTADCLAISHMEPGFGLEIHDGGSALKFV 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   467 DTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVN----PGTSPLLRYAAWT 542
Cdd:PHA03281 481 DAAESLSGLYVFIIHFNGHVEAVAYTVVSTIDHFVNAIEEHGFPPEAGNPPAPSKPKEIANNDvisePGTFPFKRYAAIT 560
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 9625942   543 GGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDK 621
Cdd:PHA03281 561 GGFAALALLCLAIALICTAKKFGHKAYRSDKAAYGQSMYYAGLPVDDFEDDEETDTDEEFGNAIGAECGGSGYTVYIDK 639
Herpes_gE pfam02480
Alphaherpesvirus glycoprotein E; Glycoprotein E (gE) of Alphaherpesvirus forms a complex with ...
193-616 0e+00

Alphaherpesvirus glycoprotein E; Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI) (pfam01688), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation.


Pssm-ID: 280617  Cd Length: 432  Bit Score: 606.09  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    193 GVRYTETWSFLPSLTCtgdaAPAIQHICLKHTTCFQDVVVDVDCAENTKEDQL--AEISYRFQGKKEADQPWIVVNTSTL 270
Cdd:pfam02480   5 GGPYTETWVWLPSPCC----APATGYICLESAHCFTDLVVDVACARYAMRAPLptAEAYVPPGPAKQIGLLSLNGVPNIL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    271 FDELELDPpeiepGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKT-RNPTPA---VTPQPRGAEFHMWNY 346
Cdd:pfam02480  81 RDRVAVVN-----GSLVILGASKQNSGLYILSVRGSTDTATQVAVVVLVVGPAPDpRLPTPRaspEVSSVRGVTVHMENP 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    347 HSHVFSVGDTFSLAMHLQYKIHE-APFDLLLEWLYVPIDPTCQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVA 425
Cdd:pfam02480 156 EAHVFSPGDTFSLNVSIIAIAHDdEPYTLDVEWLRVPYDPTCAFMRIYEACLYHPQAPECLSPADSGCAFSSNIWALRVA 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    426 STVYQNCEHADnYTAYCLGISHMEPSFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIE 505
Cdd:pfam02480 236 VRSYANCSRTD-PPRRCIAEAHMEPSPGLALTAGIPNLKFKDASPQHSGLYVCVVYVNDHVHAWAYTTLSTVAQYRNAVE 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942    506 ERGFPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGL 585
Cdd:pfam02480 315 EQHLPQRDEDPAEPTSPHEIAPPNNGTIRGALLLAAVSGAALLLVLLGLSAWACMTKRRRRRWRRVKSRLSDEGPTYIRL 394
                         410       420       430
                  ....*....|....*....|....*....|....*...
gi 9625942    586 PVDDF-----EDSESTDTEEEFGNAI--GGSHGGSSYT 616
Cdd:pfam02480 395 PVSDLyadwsEDSEGERDEVEYYQEPedSPSTNGSGYE 432
PHA03283 PHA03283
envelope glycoprotein E; Provisional
193-605 1.60e-60

envelope glycoprotein E; Provisional


Pssm-ID: 223032  Cd Length: 542  Bit Score: 210.95  E-value: 1.60e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   193 GVRYTETWSFLPS-LTCTGDAApaIQHICLKHTTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLF 271
Cdd:PHA03283  49 TTRVTKAWTFLETpPGCAGDVS--VKKVCVSTSLCEDDIVIGKHCNLLTGEHGIALAEFNVVNGSLQRTKDVYFVNGTVF 126
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   272 DELELDPPeiepgVLKVLRTEKQYLGVYIWNMRGsDGTSTYATFLVTWKGDEKTRNPTPA----VTPQPRGAEFHMWNYH 347
Cdd:PHA03283 127 PILTPERS-----VLQIQRATPNIAGVYTLHVSS-DGMMKHSVFFVTVKKPPKQPQTPPAplvpQVPARHHTDFHVRGYH 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   348 SHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVAST 427
Cdd:PHA03283 201 SRVYSPGDSFDLSVHLESDIGDPSFSATIDWYYMNTSSSCDLFRVYETCIFHPTAMACLHPEDPACSFTSPARATKILHR 280
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   428 VYQNCEH-ADNYTAYCLGISHMEPSFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEE 506
Cdd:PHA03283 281 VYGNCSPrGDRWPSRCHSTLLGNRPHFIQPAQNRVDLLFKNAPASASGLYVFVLLYNGHPEAWTYTLLSTAAHFMNVITD 360
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   507 RGFPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWT----------GGLAAVVLLCLVIFLICTAKRMRVKAYRVdksPY 576
Cdd:PHA03283 361 LTRPRLGEHAIYTDLGHGVTTPHPSAATTNELGAWTrhylafllaiICTCAALLVALVVWGCILYRRSNRKPYEV---LN 437
                        410       420       430
                 ....*....|....*....|....*....|....*.
gi 9625942   577 NQSMYYAGLPVDDFED-------SESTDTEEEFGNA 605
Cdd:PHA03283 438 PFETVYTSVPSNDPEVlvferlaSDSDDSFDSSSDE 473
PHA03282 PHA03282
envelope glycoprotein E; Provisional
326-601 4.04e-30

envelope glycoprotein E; Provisional


Pssm-ID: 165539 [Multi-domain]  Cd Length: 540  Bit Score: 124.66  E-value: 4.04e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   326 RNPTPAVTPQP-------RGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHE-APFDLLLEWLYVPIDPTCQPMRLYSTCL 397
Cdd:PHA03282 193 LHPPPAPHPHPiaevahvRGVTVSLRTQTAILFSPGDTVHTNVSIHPIAHDdDPYVMEVVWVRFDVPEECGEMRIYEPCL 272
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   398 YHPNAPQCLSHMNSGCTFTSphLAQRVASTVYQNCEHAdNYTAYCLGISHMEPSFGLILHDGGTTLKFVDTPESLSGLYV 477
Cdd:PHA03282 273 YHPQLPECRSPADAPCAASV--WTERLAVRRYGPCSRT-VPPPRCPADAAMEPRPGLGWYGHTVNLQLRDASEASGGLYV 349
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   478 FVVYFNGHVEAVAYTVVSTVDHFVNAIEERGfPPTAGQPPATTKPkEITPvnPGTSPLLRYAAWTGGL--AAVVL--LCL 553
Cdd:PHA03282 350 CVVYVNGHVHAWGHVVISTAARYRNAVVERS-LPRYRPPPVEPTP-SARP--PGPRPAARGALRLVGVlgAALGLaaAGL 425
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 9625942   554 VIFLICTAKRMRvkAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEE 601
Cdd:PHA03282 426 SVWACVTCRRAR--AWRAVKSRDSGTPTYIRLADDELYADLSSDGEGE 471
PHA03286 PHA03286
envelope glycoprotein E; Provisional
193-621 1.74e-28

envelope glycoprotein E; Provisional


Pssm-ID: 177576  Cd Length: 492  Bit Score: 119.25  E-value: 1.74e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   193 GVRYTETWSFLPSL---TCTGdaapaiqHICLKHTTCFQDVVVDVDCAENTKEDQLAeiSYRFqgkkeadqpwiVVNTST 269
Cdd:PHA03286  45 GTIYTETWTWISNIcneTATG-------YVCLDSATCFQDLILGTSCVRYGEEKILR--TDRF-----------VVNSGS 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   270 LfDELELDPPEIEPGV---------LKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPA--VTPQPRG 338
Cdd:PHA03286 105 L-KRIESSQLHYIPNViigtgrgkeLTILNASSQNAGIYIRYSRNGTRTAVMDVLVVWVSGHGRARDPTMNipITPPSTR 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   339 AEFHMWNYHSHVFSVGDTF--SLAMHLQYKIheAPFDLLLEWLYVPIDPTCQPMRLYSTCLYHPNAPQCLS-HMNSGCTF 415
Cdd:PHA03286 184 VDLSLKNFKAFLYNVGDTVdaSVTAHLTNWA--GAFSLEFRVLFLPYNPKCKYLTIYEPCIFHPKEPECIMvPEHSECRF 261
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   416 TSPHLAQRVASTVYQNCEHADNYTAYCLGISH-MEPSFGLiLHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVV 494
Cdd:PHA03286 262 ASNMDVLQIAAARSDNCSVGVRGCTYDTSVDEsVQGRLAF-LESDIPSFRLANAQPTDAGLYVVVALYNGRPLAWTYVYL 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9625942   495 STVDHFVNAIE---ERGF---------PPTAGQPPATTKPKEitpvnpgTSPLLRYAAWTGGLAAVVLLCLVIFLICTAK 562
Cdd:PHA03286 341 STLETILNVFEdvhKPGFgynavsandPGNFTAAPTHTIAFK-------EGPTVIYSLLVSSMAAGAILVVLLFALCIAG 413
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 9625942   563 RMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSH--------GGSSYTVYIDK 621
Cdd:PHA03286 414 LYRRRRRHRTNGYFQAYPKYMSLPSNDEGDFNSPLSNTCEGLSRGLANeksrtpkqKGSRYHAWLAD 480
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH