NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|47419907|ref|NP_057653|]
View 

T-box transcription factor TBX3 isoform 2 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
T-box_TBX2_3-like cd20188
DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This ...
104-305 1.12e-149

DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This subfamily includes the T-box transcription factors TBX2 and TBX3 and similar proteins. TBX2 is an oncogenic transcription factor implicated in developmental processes, including coordinating cell fate, patterning and morphogenesis of a wide range of tissues and organs. It is overexpressed in several cancers, including melanoma and breast, and plays a key role during cardiac development. TBX2 is a negative regulator of promyelocytic leukemia protein (PML) function in cellular senescence, and it interacts with HP1 to recruit a repression complex to EGR1-responsive promoters to drive the proliferation of breast cancer cells. TBX3 has also been implicated in oncogenesis in breast cancer and melanoma. The tbx3 gene is downregulated by PML. TBX3 directly represses TBX2 under the control of the PRC2 complex in skeletal muscle and rhabdomyosarcoma. Also included in this family is the Drosophila melanogaster optomotor-blind protein (Omb, also known as lethal(1)optomotor-blind, or L(1)omb, or protein bifid) which controls many developmental processes such as wing, eye, and abdominal tergites and optic lobes, and induces epithelial cell migration and extrusion in vivo. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


:

Pssm-ID: 410314  Cd Length: 185  Bit Score: 433.40  E-value: 1.12e-149
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20188   4 KVELEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKR 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgtqTILNSMHKYQPRFHIVRANDILKL 263
Cdd:cd20188  84 MYIHPDSPSTGEQWMQKVVSFHKLKLTNNISDKHGF--------------------TILNSMHKYQPRFHIVRANDILKL 143
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20188 144 PYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRD 185
TBX pfam12598
T-box transcription factor; This domain family is found in eukaryotes, and is typically ...
323-403 6.26e-22

T-box transcription factor; This domain family is found in eukaryotes, and is typically between 77 and 89 amino acids in length. The family is found in association with pfam00907. There are two completely conserved residues (S and P) that may be functionally important. T-box genes encode transcription factors involved in morphogenesis and organogenesis of vertebrates and invertebrates


:

Pssm-ID: 403708  Cd Length: 83  Bit Score: 90.20  E-value: 6.26e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   323 RVFDERHK--KENGTSDESSSEQAAFNcfAQASSPAASTVgtSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTS 400
Cdd:pfam12598   1 RMYEEQCKqdRDGGTSDASSSEQTAGR--DQASSPAGPAV--SPLKFHRPSREDSDCCADSDDELDQEGPESGKISTTTS 76

                  ...
gi 47419907   401 EEP 403
Cdd:pfam12598  77 ESP 79
 
Name Accession Description Interval E-value
T-box_TBX2_3-like cd20188
DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This ...
104-305 1.12e-149

DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This subfamily includes the T-box transcription factors TBX2 and TBX3 and similar proteins. TBX2 is an oncogenic transcription factor implicated in developmental processes, including coordinating cell fate, patterning and morphogenesis of a wide range of tissues and organs. It is overexpressed in several cancers, including melanoma and breast, and plays a key role during cardiac development. TBX2 is a negative regulator of promyelocytic leukemia protein (PML) function in cellular senescence, and it interacts with HP1 to recruit a repression complex to EGR1-responsive promoters to drive the proliferation of breast cancer cells. TBX3 has also been implicated in oncogenesis in breast cancer and melanoma. The tbx3 gene is downregulated by PML. TBX3 directly represses TBX2 under the control of the PRC2 complex in skeletal muscle and rhabdomyosarcoma. Also included in this family is the Drosophila melanogaster optomotor-blind protein (Omb, also known as lethal(1)optomotor-blind, or L(1)omb, or protein bifid) which controls many developmental processes such as wing, eye, and abdominal tergites and optic lobes, and induces epithelial cell migration and extrusion in vivo. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410314  Cd Length: 185  Bit Score: 433.40  E-value: 1.12e-149
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20188   4 KVELEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKR 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgtqTILNSMHKYQPRFHIVRANDILKL 263
Cdd:cd20188  84 MYIHPDSPSTGEQWMQKVVSFHKLKLTNNISDKHGF--------------------TILNSMHKYQPRFHIVRANDILKL 143
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20188 144 PYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRD 185
T-box pfam00907
T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box ...
105-305 1.19e-122

T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations.


Pssm-ID: 395727  Cd Length: 182  Bit Score: 364.19  E-value: 1.19e-122
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   105 VHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRM 184
Cdd:pfam00907   1 VSLENKELWKKFHELGTEMIITKSGRRMFPTLKVSVSGLDPNALYSVLLDIVPVDDKRYKFHNGKWVVAGKAEPHSPPRV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   185 YIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVR-ANDILKL 263
Cdd:pfam00907  81 YIHPDSPATGEHWMKQPVSFDKLKLTNNKSDKNG--------------------HIILNSMHKYQPRLHIVRvGGDRPPL 140
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 47419907   264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:pfam00907 141 PEENVKTFSFPETEFIAVTAYQNEEITQLKIDNNPFAKGFRD 182
TBOX smart00425
Domain first found in the mice T locus (Brachyury) protein;
104-310 3.11e-112

Domain first found in the mice T locus (Brachyury) protein;


Pssm-ID: 214656  Cd Length: 190  Bit Score: 337.70  E-value: 3.11e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907    104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:smart00425   2 KVSLEDKELWRKFHELGTEMIVTKSGRRMFPTLKYKVSGLDPNALYSVLMDLVPVDDKRYKFNNGKWVVAGKAEPHMPSR 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907    184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgTQTILNSMHKYQPRFHIVRANDILKL 263
Cdd:smart00425  82 VYVHPDSPATGAHWMKQPVSFDKVKLTNNQSDKNGH------------------LQIILNSMHKYQPRLHIVEVDDISKE 143
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 47419907    264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGR 310
Cdd:smart00425 144 ILSQFKTFVFPETQFIAVTAYQNQKITKLKIDNNPFAKGFRDQGRRR 190
TBX pfam12598
T-box transcription factor; This domain family is found in eukaryotes, and is typically ...
323-403 6.26e-22

T-box transcription factor; This domain family is found in eukaryotes, and is typically between 77 and 89 amino acids in length. The family is found in association with pfam00907. There are two completely conserved residues (S and P) that may be functionally important. T-box genes encode transcription factors involved in morphogenesis and organogenesis of vertebrates and invertebrates


Pssm-ID: 403708  Cd Length: 83  Bit Score: 90.20  E-value: 6.26e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   323 RVFDERHK--KENGTSDESSSEQAAFNcfAQASSPAASTVgtSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTS 400
Cdd:pfam12598   1 RMYEEQCKqdRDGGTSDASSSEQTAGR--DQASSPAGPAV--SPLKFHRPSREDSDCCADSDDELDQEGPESGKISTTTS 76

                  ...
gi 47419907   401 EEP 403
Cdd:pfam12598  77 ESP 79
 
Name Accession Description Interval E-value
T-box_TBX2_3-like cd20188
DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This ...
104-305 1.12e-149

DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This subfamily includes the T-box transcription factors TBX2 and TBX3 and similar proteins. TBX2 is an oncogenic transcription factor implicated in developmental processes, including coordinating cell fate, patterning and morphogenesis of a wide range of tissues and organs. It is overexpressed in several cancers, including melanoma and breast, and plays a key role during cardiac development. TBX2 is a negative regulator of promyelocytic leukemia protein (PML) function in cellular senescence, and it interacts with HP1 to recruit a repression complex to EGR1-responsive promoters to drive the proliferation of breast cancer cells. TBX3 has also been implicated in oncogenesis in breast cancer and melanoma. The tbx3 gene is downregulated by PML. TBX3 directly represses TBX2 under the control of the PRC2 complex in skeletal muscle and rhabdomyosarcoma. Also included in this family is the Drosophila melanogaster optomotor-blind protein (Omb, also known as lethal(1)optomotor-blind, or L(1)omb, or protein bifid) which controls many developmental processes such as wing, eye, and abdominal tergites and optic lobes, and induces epithelial cell migration and extrusion in vivo. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410314  Cd Length: 185  Bit Score: 433.40  E-value: 1.12e-149
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20188   4 KVELEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKR 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgtqTILNSMHKYQPRFHIVRANDILKL 263
Cdd:cd20188  84 MYIHPDSPSTGEQWMQKVVSFHKLKLTNNISDKHGF--------------------TILNSMHKYQPRFHIVRANDILKL 143
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20188 144 PYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRD 185
T-box pfam00907
T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box ...
105-305 1.19e-122

T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations.


Pssm-ID: 395727  Cd Length: 182  Bit Score: 364.19  E-value: 1.19e-122
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   105 VHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRM 184
Cdd:pfam00907   1 VSLENKELWKKFHELGTEMIITKSGRRMFPTLKVSVSGLDPNALYSVLLDIVPVDDKRYKFHNGKWVVAGKAEPHSPPRV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   185 YIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVR-ANDILKL 263
Cdd:pfam00907  81 YIHPDSPATGEHWMKQPVSFDKLKLTNNKSDKNG--------------------HIILNSMHKYQPRLHIVRvGGDRPPL 140
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 47419907   264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:pfam00907 141 PEENVKTFSFPETEFIAVTAYQNEEITQLKIDNNPFAKGFRD 182
T-box_TBX4_5-like cd20189
DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This ...
104-305 6.14e-113

DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This subfamily includes the T-box transcription factors TBX4 and TBX5 which play important roles in vertebrate limb and heart development, and in lung and trachea development. TBX4 is needed for normal skeletal and muscular hindlimb development and is involved in super-enhancer-driven transcriptional programs underlying features specific to lung fibroblasts. TBX5 plays a role in regulating cardiac conduction system function, and in coordinating forelimb muscle pattern. Mutations in human TBX5 and TBX4 are associated with Holt-Oram syndrome and Small Patella syndrome, respectively. Both syndromes are characterized by limb defects in addition to other abnormalities. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410315  Cd Length: 185  Bit Score: 339.02  E-value: 6.14e-113
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20189   2 KVFLENRELWQKFHEVGTEMIITKAGRRMFPSIKVKVTGLNPKTKYILLMDIVPADDHRYKFHDSEWVVAGKAEPAMPGR 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRANDILK- 262
Cdd:cd20189  82 LYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDQFG--------------------HIILNSMHKYQPRIHIVQADDNNAf 141
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....
gi 47419907 263 -LPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20189 142 gSKNTAFSTHVFPETAFIAVTAYQNHQITQLKIENNPFAKGFRG 185
TBOX smart00425
Domain first found in the mice T locus (Brachyury) protein;
104-310 3.11e-112

Domain first found in the mice T locus (Brachyury) protein;


Pssm-ID: 214656  Cd Length: 190  Bit Score: 337.70  E-value: 3.11e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907    104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:smart00425   2 KVSLEDKELWRKFHELGTEMIVTKSGRRMFPTLKYKVSGLDPNALYSVLMDLVPVDDKRYKFNNGKWVVAGKAEPHMPSR 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907    184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgTQTILNSMHKYQPRFHIVRANDILKL 263
Cdd:smart00425  82 VYVHPDSPATGAHWMKQPVSFDKVKLTNNQSDKNGH------------------LQIILNSMHKYQPRLHIVEVDDISKE 143
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 47419907    264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGR 310
Cdd:smart00425 144 ILSQFKTFVFPETQFIAVTAYQNQKITKLKIDNNPFAKGFRDQGRRR 190
T-box_TBX20-like cd20193
DNA-binding domain of T-box transcription factor 20 and related T-box proteins; TBX20 is a ...
106-306 4.72e-97

DNA-binding domain of T-box transcription factor 20 and related T-box proteins; TBX20 is a T-box transcriptional factor which functions in embryonic development and its deficiency is associated with congenital heart disease. It acts both as a transcriptional activator and a repressor required for cardiac development, and has key roles in maintaining the functional and structural phenotypes in the adult heart. The TBX20-cardiac transcription factor CASZ1 protein complex is protective against dilated cardiomyopathy and is essential for maintaining cardiac homeostasis. TBX20 has also been shown to regulate angiogenesis through the PROK2-PROKR1 (prokineticin receptor 1) pathway and is involved in both, pathological and developmental, angiogenesis. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410319  Cd Length: 190  Bit Score: 298.19  E-value: 4.72e-97
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 106 HLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKF--HNSRWMVAGKADPEMPKR 183
Cdd:cd20193   4 HLETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGVDPDAKYIVLMDIVPVDNKRYRYayHRSSWLVAGKADPPLPAR 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVR----AND 259
Cdd:cd20193  84 LYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDKHG--------------------HIILNSMHKYQPRVHIVKkkdhTAS 143
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 47419907 260 ILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDT 306
Cdd:cd20193 144 LVNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDS 190
T-box_TBX1_10-like cd20187
DNA-binding domain of T-box transcription factor 1 and 10, and related T-box proteifactors; ...
104-305 2.38e-95

DNA-binding domain of T-box transcription factor 1 and 10, and related T-box proteifactors; This subfamily includes TBX1 and TBX10. TBX1 is a T-box transcription factor which plays an important role in heart development and has been implicated in DiGeorge or 22q11.2 deletion syndrome. This syndrome is associated with various types of cardiac outflow tract (OFT) and vascular defects. Wnt5a is regulated by TBX1 in the second heart field (SHF). TBX1 is required to maintain the integrity of extracellular matrix-cell interactions in the SHF and this interaction is critical for cardiac (OFT) development. TBX10 is a putative T-box transcription factor. Diseases associated with TBX10 include Isolated Cleft Lip and Cleft Lip/cleft lip with or without cleft palate. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410313  Cd Length: 189  Bit Score: 293.95  E-value: 2.38e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYK--FHNSRWMVAGKADPEMP 181
Cdd:cd20187   3 TVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKIFGMDPMADYMLMMDFVPVDDKRYRyaFHSSSWLVAGKADPAMP 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 182 KRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRAN--- 258
Cdd:cd20187  83 GRIHVHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNG--------------------HIILNSMHRYQPRFHVVYVDprk 142
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 47419907 259 DILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20187 143 DSENSAEENFKTFIFPETKFTAVTAYQNHRITQLKIASNPFAKGFRD 189
T-box_VegT-like cd20197
DNA-binding domain of Xenopus VegT and related T-box proteins; VegT, (also known as Antipodean, ...
104-305 1.36e-90

DNA-binding domain of Xenopus VegT and related T-box proteins; VegT, (also known as Antipodean, Brat and Xombi), is a T-box transcription factor required in early Xenopus embryos for the formation of both, the mesoderm and endoderm germ layers. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410323  Cd Length: 183  Bit Score: 281.34  E-value: 1.36e-90
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20197   2 RASLEDQDLWKKFHQIGTEMIITKSGRRMFPQCKIRVSGLLPYAKYVMLVDFVPVDNFRYKWNKDQWEVAGKAEPQPPCR 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRANDILKL 263
Cdd:cd20197  82 TYVHPDSPAPGSHWMKQPISFQKLKLTNNTLDQHG--------------------HIILHSMHRYQPRFHIVQADDLFNV 141
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20197 142 RWSLFQVFSFPETVFTAVTAYQNEKITKLKIDNNPFAKGFRE 183
T-box_Drosocross-like cd20681
DNA-binding domain of Drosophila Dorsocross and related T-box proteins; Drosophila Dorsocross ...
104-305 5.77e-90

DNA-binding domain of Drosophila Dorsocross and related T-box proteins; Drosophila Dorsocross (Doc) includes three Dorsocross paralogs, Doc1-3. These are key cardiogenic T-box transcription factors during specification and differentiation of heart cells. Drosophila Doc also functions in caudal visceral mesoderm development, and modulates Notch signaling in the developing Drosophila eye by regulating the expression of Delta in the eye imaginal discs. Doc also functions in the morphogenesis of epithelial tissues: in Drosophila, which possesses a single extraembryonic (EE) membrane, it is essential for EE epithelia tissue maintenance while in Tribolium castaneum, which has 2 EE membranes, Doc plays a major role in EE morphogenetic events throughout development without affecting EE tissue specificity or maintenance. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410332  Cd Length: 186  Bit Score: 279.60  E-value: 5.77e-90
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKF-HNSRWMVAGKADPE--M 180
Cdd:cd20681   2 KVTLKNRDLWQQFHREGTEMIITKSGRRMFPSLRLSVSGLEPDARYCVLLEMVLASDCRFKYsGNGGWVPAGGAEPQppL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 181 PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRANDI 260
Cdd:cd20681  82 PRRIYIHPDSPATGDHWMSQPISFSKVKLTNNTLDPQG--------------------NIVLTSMHKYQPRIHIVRCSDT 141
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*
gi 47419907 261 LKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20681 142 LALPWAPTASFTFPETEFIAVTAYQNERITKLKIDNNPFAKGFRE 186
T-box cd00182
DNA-binding domain of the T-box transcription factor family; The T-box family is an ancient ...
104-297 4.59e-86

DNA-binding domain of the T-box transcription factor family; The T-box family is an ancient family of transcription factors which plays a multitude of diverse functions throughout development. The founding member of the family is Brachyury (also known as TBXT, or T). Members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns. The T-box factors in Caenorhabditis elegans have evolved very differently than those in other organisms; its genome contains 22 T-box genes which encode factors which are diverse in DNA-binding specificity, function and sequence, and only 3 of these factors fall into the conserved T-box subfamilies.


Pssm-ID: 410312  Cd Length: 176  Bit Score: 269.08  E-value: 4.59e-86
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM-PK 182
Cdd:cd00182   2 TVSLRNEELWKKFHELGTEMIVTKSGRRMFPTLEYSVSGLDPNKLYSVSLHFERVDNKRYKFNNGKWVPSGKAEPPPePS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 183 RMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHgftlafpsdhatwqgnysfGTQTILNSMHKYQPRFHIVRANDIlK 262
Cdd:cd00182  82 RIYVHPDGPQTGSFWMKKGVSFDKVKITNNKEDKK-------------------EGHILLHSMHKYIPVLTIYEVDDN-G 141
                       170       180       190
                ....*....|....*....|....*....|....*
gi 47419907 263 LPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNN 297
Cdd:cd00182 142 LLSKLVKEFRFPETEFIAVTAYQNDEITQLKIDNN 176
T-box_TBX6_VegT-like cd20190
DNA-binding domain of T-box transcription factor 6, VegT and related T-box proteins; This ...
105-305 2.16e-83

DNA-binding domain of T-box transcription factor 6, VegT and related T-box proteins; This subfamily includes the transcriptional regulators TBX6 and VegT. TBX6 plays an essential role in the fate determination of axial stem to become either neural or mesodermal. It also plays an essential role in the regulation of left/right patterning in mouse embryos through effects on nodal cilia and perinodal signaling. VegT (also known as Antipodean, Brat and Xombi) is required in early Xenopus embryos for the formation of both the mesoderm and endoderm germ layers. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved 1DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410316  Cd Length: 183  Bit Score: 262.51  E-value: 2.16e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 105 VHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRM 184
Cdd:cd20190   3 LSLEDRELWKEFSSVGTEMIITKSGRRMFPACKVSVTGLDPEAKYLFLLDVVPVDNARYKWNKRRWEPSGKAEPHLPDRV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 185 YIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRANDILKLP 264
Cdd:cd20190  83 YIHPDSPAPGAHWMRQPISFHKLKLTNNTLDPHG--------------------HLILHSMHKYQPRIHLVQSADLCSQH 142
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
gi 47419907 265 YSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20190 143 WGGMASFRFPETTFIAVTAYQNPQITKLKIAANPFAKGFRE 183
T-box-like cd20682
T-box DNA-binding domain; uncharacterized subfamily; The T-box family is an ancient group that ...
104-305 2.11e-82

T-box DNA-binding domain; uncharacterized subfamily; The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.


Pssm-ID: 410333  Cd Length: 191  Bit Score: 260.01  E-value: 2.11e-82
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYK--FHNSRWMVAGKADPEMP 181
Cdd:cd20682   2 QVELCSRELWLQFHNLGNEMIITKAGRRMFPALKVKLTGLDPDKLYIVWVDIVPVDSNRYRyvYHSSKWVVAGSGDVLPP 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 182 KRMYIHPDSPATGEQWMSKVVTFHKLKLTNNisdkhgftlafpsDHATWQGnysfgtQTILNSMHKYQPRFHIVRANDIL 261
Cdd:cd20682  82 ANRYIHPDSPASGKYWMSQIVSFDKLKLTNN-------------KEPKQKG------QISLHSMHKYQPRIHIQPVEDDG 142
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*....
gi 47419907 262 KLPY-----STFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20682 143 RNVEkainsSKALSFEFPETSFITVTAYQNQQITKLKIASNPFAKGFRD 191
T-box_TBXT_TBX19-like cd20192
DNA-binding domain of T-box transcription factor T, T-box transcription factor 19 and related ...
104-305 4.02e-79

DNA-binding domain of T-box transcription factor T, T-box transcription factor 19 and related T-box proteins; Tbx19 (also known as Tpit) is a T-box factor restricted to two pituitary (pro-opiomelanocortin) POMC-expressing lineages, the corticotrophs and melanotrophs; it controls terminal differentiation of these lineages. TBX19 activates POMC gene transcription with the cooperation of another transcription factor Pitx1. TBXT, also known as Brachyury protein, or protein T, is a transcription factor needed for posterior mesoderm formation and differentiation as well as for the notochord development during embryogenesis. It binds to a 24 base-pair (bp) palindromic site (called the T site) and activates gene transcription when bound to such a site. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. TBXT is the founding member of the T-box family, members of which share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410318  Cd Length: 180  Bit Score: 251.03  E-value: 4.02e-79
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20192   2 RVTLEDRELWKKFHSLTNEMIVTKSGRRMFPVLKVSVSGLDPNAMYSVLLDFVQVDNHRWKYVNGEWVPGGKAEPPPPSS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDkhgftlafpsdhatwqgnysfGTQTILNSMHKYQPRFHIVRAN-DILK 262
Cdd:cd20192  82 VYVHPDSPNFGAHWMKGPVSFSKVKLTNKPNG---------------------EGQIMLNSLHKYEPRVHIVRVGsNNHE 140
                       170       180       190       200
                ....*....|....*....|....*....|....*....|...
gi 47419907 263 LPYSTFRtylFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20192 141 RLVSTFS---FPETQFIAVTAYQNEEITALKIKYNPFAKAFLD 180
T-box_TBX6 cd20196
DNA-binding domain of T-box transcription factor 6, and related T-box proteins; TBX6 is a ...
104-305 2.51e-78

DNA-binding domain of T-box transcription factor 6, and related T-box proteins; TBX6 is a T-box transcription factor which plays an essential role in the fate determination of axial stem to become either neural or mesodermal. It also plays an essential role in the regulation of left/right patterning in mouse embryos, through effects on nodal cilia and perinodal signaling. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410322  Cd Length: 182  Bit Score: 249.01  E-value: 2.51e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20196   2 RMSLENAELWKQFSSVGTEMIITKAGRRMFPQLRVSVSGLDPEARYLLLLDVVPVDGSRYRWQGNSWEASGKAEPRLPDR 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgtqTILNSMHKYQPRFHIVRANDILkL 263
Cdd:cd20196  82 VYIHPDSPATGAHWMRQPISFHRAKLTNNTLDPHGH--------------------IILHSMHRYQPRVHVVRARDVL-S 140
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20196 141 WGGGCASFTFPETQFITVTAYQNPKITQLKINSNPFAKGFRE 182
T-box_TBX15_18_22-like cd20191
DNA-binding domain of T-box transcription factor 15, 18 and 22, and related T-box proteins; ...
104-305 4.15e-78

DNA-binding domain of T-box transcription factor 15, 18 and 22, and related T-box proteins; This subfamily includes the transcriptional regulators TBX15, TBX18 and TBX22 which are involved in various developmental processes. TBX15 (also known as TBX14) plays an important role in the development of the skeleton of the limb, vertebral column and head, possibly through its control of the number of mesenchymal precursor cells and chondrocytes; it also plays a role in the differentiation of brown and brite adipocytes. TBX18 is involved in the developmental processes of a variety of tissues and organs, including the ureter, vertebral column. epicardium and coronary vessels; it is important for the development of the head portion of the sino atrial node (SAN). Mutations in the T-box transcription factor gene TBX22 are found in X-linked Cleft Palate with or without Ankyloglossia syndrome (CPX syndrome), and associated with cleft lip and palate, and tooth agenesis. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410317  Cd Length: 194  Bit Score: 249.04  E-value: 4.15e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKF--HNSRWMVAGKADPEMP 181
Cdd:cd20191   4 QVELQGSELWKRFHDIGTEMIITKAGRRMFPAIRVKVSGLDPHAQYIVAMDIVPVDNKRYRYvyHSSKWMVAGNADAPVP 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 182 KRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFtlafpsdhatwqgnysfgtqTILNSMHKYQPRFHIVR----- 256
Cdd:cd20191  84 PRVYIHPDSPASGETWMRQVVSFDKLKLTNNEMDDQGH--------------------IILHSMHKYQPRVHVIRkdsst 143
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 47419907 257 --ANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20191 144 dlSPKKPVPPGEGVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRD 194
T-box_MGA-like cd20195
DNA-binding domain of MAX gene-associated protein and related T-box proteins; MGA (also known ...
104-305 4.20e-76

DNA-binding domain of MAX gene-associated protein and related T-box proteins; MGA (also known as MGAP, MAX dimerization protein, MAD5, MXD5) is a dual-specificity transcription factor that regulates the expression of both, MAX-network and T-box family target genes. MGA functions as a repressor or an activator; it binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence. Its function is activated by heterodimerization with MAX. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410321  Cd Length: 186  Bit Score: 243.11  E-value: 4.20e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20195   2 TVTLENNSMWNEFYRCGTEMILTKQGRRMFPYCRFRISGLDPDRNYILVMDISPVDNFRYRWNGRWWEPSGKAEPHVLGR 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdHAtwqgnysfgtqtILNSMHKYQPRFHIV---RANDI 260
Cdd:cd20195  82 VFIHPESPATGRHWMDQPVSFYKLKLTNNTLDQEG--------HI------------ILHSMHRYLPRLHVVpadKEVDV 141
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*
gi 47419907 261 LKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20195 142 IQLNGPDVHTFTFPQTEFFAVTAYQNKQITQLKIDYNPFAKGFRE 186
T-box_TBR1_2_21-like cd20194
DNA-binding domain of T-box brain protein 1 and 2, T-box transcription factor 21 and related ...
105-305 1.54e-72

DNA-binding domain of T-box brain protein 1 and 2, T-box transcription factor 21 and related T-box proteins; TBX21 (also known as T-cell-specific T-box transcription factor T-bet or transcription factor TBLYM) is a lineage-defining transcription factor which directs T helper type 1 (Th1) cell differentiation. This subfamily includes TBR1 (also known as T-brain-1, or TES-56), which is a neuron-specific transcription factor involved in forebrain development, and TBR2 (also known as Eomesodermin, Eomes, or T-brain-2), which is associated with neurogenesis, cardiogenesis and tumor immune response. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410320  Cd Length: 185  Bit Score: 233.91  E-value: 1.54e-72
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 105 VHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMP-KR 183
Cdd:cd20194   4 VYLCNRDLWLKFHQHQTEMIITKQGRRMFPTLSFNLSGLDPTAHYNVFVDMVLADPNHWKFQSGKWVPCGKAEGLPQgNR 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTlafpsdhatwqgnysfgtqtILNSMHKYQPRFHIVRANDILKL 263
Cdd:cd20194  84 VYVHPDSPNTGAHWMKQEISFSKLKLTNNKGADQGMI--------------------VLNSMHKYQPRIHVIEVGGNGPN 143
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20194 144 EQRNLQTHSFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRD 185
T-box_TBX22-like cd20200
DNA-binding domain of T-box transcription factor 22 and related T-box proteins; TBX22 is a ...
104-305 9.38e-70

DNA-binding domain of T-box transcription factor 22 and related T-box proteins; TBX22 is a transcriptional regulator involved in developmental processes. Mutations in the T-Box transcription factor gene TBX22 are found in X-linked Cleft Palate with or without Ankyloglossia syndrome (CPX syndrome). TBX22 mutation is also associated with cleft lip and palate, and tooth agenesis. This subgroup belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410326  Cd Length: 194  Bit Score: 226.73  E-value: 9.38e-70
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYK--FHNSRWMVAGKADPE-M 180
Cdd:cd20200   4 QVELQGSELWKRFHEIGTEMIITKAGRRMFPSVRVKVKGLDPLKQYYIAMDVVPVDSKRYRyvYHSSQWMVAGNTDHScI 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 181 PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIV----R 256
Cdd:cd20200  84 TPRLYVHPDSPCSGETWMRQIISFDRVKLTNNEMDDKG--------------------HIILQSMHKYKPRVHVIlqdsR 143
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 47419907 257 AN--DILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20200 144 FDlsQIQSLPAEGVKTFSFPETEFTTVTAYQNQQITKLKIDRNPFAKGFRD 194
T-box_TBX18_like cd20199
DNA-binding domain of T-box transcription factor 18 and related T-box proteins; TBX18 acts as ...
104-305 4.45e-67

DNA-binding domain of T-box transcription factor 18 and related T-box proteins; TBX18 acts as a transcription repressor involved in the developmental processes of a variety of tissues and organs, including the ureter, vertebral column. epicardium and coronary vessels. TBX18 is important for the development of the head portion of the sino atrial node (SAN); SAN is the pacemaker region of the heart that initiates each heartbeat. This subgroup belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410325  Cd Length: 195  Bit Score: 219.92  E-value: 4.45e-67
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKF--HNSRWMVAGKADPEMP 181
Cdd:cd20199   5 RVDLQGADLWKRFHEIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYvyHSSKWMVAGNADSPVP 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 182 KRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRA---- 257
Cdd:cd20199  85 PRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQG--------------------HIILHSMHKYQPRVHVIRKecge 144
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 47419907 258 --NDILKLPYST-FRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20199 145 elSPVKPIPSGEgVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRD 195
T-box_TBX21 cd20203
DNA-binding domain of T-box transcription factor 21 and related T-box proteins; TBX21 (also ...
104-305 1.37e-66

DNA-binding domain of T-box transcription factor 21 and related T-box proteins; TBX21 (also known as T-cell-specific T-box transcription factor T-bet or transcription factor TBLYM) is a lineage-defining transcription factor which directs T helper type 1 (Th1) cell differentiation. It initiates Th1 lineage development from naive T helper precursor cells both by initiating the Th1 genetic programs and by inhibiting the opposing Th2 and Th17 lineage-commitment programs. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410329  Cd Length: 191  Bit Score: 218.29  E-value: 1.37e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMP-K 182
Cdd:cd20203   3 QVLLNNHPLWSKFHKHQTEMIITKQGRRMFPFLSFNLTGLDPTAHYNVYVDVVLADQHHWRYQGGKWVQCGKAEGNMPgN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 183 RMYIHPDSPATGEQWMSKVVTFHKLKLTNNisdkhgftlafpsdhatwQGNYSFGTQTI-LNSMHKYQPRFHIVRAND-- 259
Cdd:cd20203  83 RLYVHPDSPNTGAHWMRQEVSFGKLKLTNN------------------KGASNNVTQMIvLQSLHKYQPRLHIVEVKEge 144
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 47419907 260 -ILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20203 145 tEEAYSSSKTHTFTFPETQFIAVTAYQNAEITQLKIDHNPFAKGFRD 191
T-box_TBXT cd20202
DNA-binding domain of T-box transcription factor T and related T-box proteins; TBXT, also ...
104-305 5.89e-64

DNA-binding domain of T-box transcription factor T and related T-box proteins; TBXT, also known as Brachyury protein, or protein T, is a transcription factor needed for posterior mesoderm formation and differentiation as well as for the notochord development during embryogenesis. It binds to a 24 base-pair (bp) palindromic site (called the T site) and activates gene transcription when bound to such a site. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. TBXT is the founding member of the T-box family, members of which share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410328  Cd Length: 179  Bit Score: 210.67  E-value: 5.89e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20202   3 KVSLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSC 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDkhgftlafpsdhatwqgnysfGTQTILNSMHKYQPRFHIVRANDILKL 263
Cdd:cd20202  83 VYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNG---------------------GGQIMLNSLHKYEPRIHIVRVGGPQRM 141
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 pystFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20202 142 ----ITSHSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLD 179
T-box_TBX15-like cd20198
DNA-binding domain of T-box transcription factor 15 and related T-box proteins; TBX15 (also ...
104-305 6.20e-64

DNA-binding domain of T-box transcription factor 15 and related T-box proteins; TBX15 (also known as TBX14) plays an important role in the development of the skeleton of the limb, vertebral column and head, possibly through its control of the number of mesenchymal precursor cells and chondrocytes. TBX15 also plays a role in the differentiation of brown and brite adipocytes. This subgroup belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410324  Cd Length: 198  Bit Score: 211.51  E-value: 6.20e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKF--HNSRWMVAGKADPEMP 181
Cdd:cd20198   8 QVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYvyHSSKWMVAGNADSPVP 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 182 KRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGftlafpsdhatwqgnysfgtQTILNSMHKYQPRFHIVRANDIL 261
Cdd:cd20198  88 PRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQG--------------------HIILHSMHKYQPRVHVIRKDFSS 147
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 47419907 262 KLPYST-------FRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20198 148 DLSPTKpvptgdgVKTFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRD 198
T-box_Fungi_incertae_sedis cd20683
T-box DNA-binding domain; uncharacterized subfamily of fungi classified as Fungi incertae ...
105-306 9.83e-62

T-box DNA-binding domain; uncharacterized subfamily of fungi classified as Fungi incertae sedis; Fungi incertae sedis refers to a fungal taxonomic group where its broader relationships are unknown or undefined. The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.


Pssm-ID: 410334  Cd Length: 214  Bit Score: 206.09  E-value: 9.83e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 105 VHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGK--------- 175
Cdd:cd20683   3 LLLEDADLWAQFHSVQNEMIITKSGRCLFPLLRFRAVNLDPKALYSIALDIEQVSPNRFRFRNGRWNPIDKdqrgddafs 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 176 -ADPEM---PKRMYIHPDSPATGEQWMSKVVTFHKLKLTN---NISDKHGftlafPSDHATWQGNYSFGTQTILNSMHKY 248
Cdd:cd20683  83 sGTADKsvlLPESYIHPDGPQTGAFWMANGISFAKIKLSNrqpNSSDRDG-----PKENITNSISALPDGHFFLTSFHKY 157
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 47419907 249 QPRFHIV-RANDILKLPYSTfrTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDT 306
Cdd:cd20683 158 QPRLHLIqHSAGDHDDILST--TFTFEETEFIAVTHYQNEKVNILKKDYNPHAKGFKDD 214
T-box_TBR1 cd20204
DNA-binding domain of T-box brain protein 1 and related T-box proteins; TBR1 (also known as ...
104-305 2.54e-57

DNA-binding domain of T-box brain protein 1 and related T-box proteins; TBR1 (also known as T-brain-1 or TES-56) is a neuron-specific transcription factor of the T-box family and involved in forebrain development. It has been recognized as a high-confidence risk gene for autism spectrum disorders (ASD); it regulates the expression of ASD-related genes that are critical for cortical development. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410330  Cd Length: 191  Bit Score: 193.41  E-value: 2.54e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMP-K 182
Cdd:cd20204   3 QVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWRFQGGKWVPCGKADTNVQgN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 183 RMYIHPDSPATGEQWMSKVVTFHKLKLTNNISdkhgftlafpsdhatwqGNYSFGTQTILNSMHKYQPRFHIVRANDILK 262
Cdd:cd20204  83 RVYMHPDSPNTGAHWMRQEISFGKLKLTNNKG-----------------ASNNNGQMVVLQSLHKYQPRLHVVEVNEDGT 145
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*.
gi 47419907 263 LPYST---FRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20204 146 EDTSQpgrVQTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRD 191
T-box_TBR2 cd20205
DNA-binding domain of T-box brain protein 2 and related T-box proteins; TBR2 (also known as ...
104-305 3.47e-57

DNA-binding domain of T-box brain protein 2 and related T-box proteins; TBR2 (also known as Eomesodermin, Eomes, or T-brain-2) is a member of the T-box family of transcription factors and is associated with neurogenesis, cardiogenesis and tumor immune response. This subfamily belongs to the T-box family of transcription factors which plays a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410331  Cd Length: 191  Bit Score: 192.97  E-value: 3.47e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMP-K 182
Cdd:cd20205   3 QVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNITGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQgN 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 183 RMYIHPDSPATGEQWMSKVVTFHKLKLTNNisdkhgftlafpsdhatwQGNYSFGTQTI-LNSMHKYQPRFHIVRAND-- 259
Cdd:cd20205  83 KVYVHPESPNTGAHWMRQEISFGKLKLTNN------------------KGANNNNTQMIvLQSLHKYQPRLHIVEVSEdg 144
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 47419907 260 --ILKLPYSTfRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20205 145 veDLNDSSKT-QTFTFPENQFIAVTAYQNTDITQLKIDHNPFAKGFRD 191
T-box_TBX19-like cd20201
DNA-binding domain of T-box transcription factor 19 and related T-box proteins; Tbx19 (also ...
104-305 1.49e-56

DNA-binding domain of T-box transcription factor 19 and related T-box proteins; Tbx19 (also known as Tpit) is a T-box factor restricted to two pituitary (pro-opiomelanocortin) POMC-expressing lineages, the corticotrophs and melanotrophs; it controls terminal differentiation of these lineages. TBX19 activates POMC gene transcription with the cooperation of another transcription factor Pitx1. Mutations of the human TPIT gene cause early onset pituitary adrenocorticotrophic hormone (ACTH) deficiency. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410327  Cd Length: 183  Bit Score: 191.01  E-value: 1.49e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 104 KVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKR 183
Cdd:cd20201   7 QVSLEDAELWQRFKEVTNEMIVTKNGRRMFPVLKISVSGLDPNAMYSFLLDFAPADGHRWKYVNGEWVPAGKPEPHSHSC 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907 184 MYIHPDSPATGEQWMSKVVTFHKLKLTNNISDkhgftlafpsdhatwqgnysfGTQTILNSMHKYQPRFHIVRANDilkl 263
Cdd:cd20201  87 VYIHPDSPNFGAHWMKAPISFSKVKLTNKLNG---------------------GGQIMLNSLHKYEPQIHIVRVGG---- 141
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 47419907 264 PYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD 305
Cdd:cd20201 142 PHRMVTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLD 183
TBX pfam12598
T-box transcription factor; This domain family is found in eukaryotes, and is typically ...
323-403 6.26e-22

T-box transcription factor; This domain family is found in eukaryotes, and is typically between 77 and 89 amino acids in length. The family is found in association with pfam00907. There are two completely conserved residues (S and P) that may be functionally important. T-box genes encode transcription factors involved in morphogenesis and organogenesis of vertebrates and invertebrates


Pssm-ID: 403708  Cd Length: 83  Bit Score: 90.20  E-value: 6.26e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47419907   323 RVFDERHK--KENGTSDESSSEQAAFNcfAQASSPAASTVgtSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTS 400
Cdd:pfam12598   1 RMYEEQCKqdRDGGTSDASSSEQTAGR--DQASSPAGPAV--SPLKFHRPSREDSDCCADSDDELDQEGPESGKISTTTS 76

                  ...
gi 47419907   401 EEP 403
Cdd:pfam12598  77 ESP 79
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH