NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|70906439|ref|NP_068656.2|]
View 

fibrinogen gamma chain isoform gamma-B precursor [Homo sapiens]

Protein Classification

Fib_alpha and FReD domain-containing protein (domain architecture ID 10554875)

Fib_alpha and FReD domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FReD super family cl00085
Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is ...
175-414 9.72e-120

Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular arrangement called the disulfide knot. The C termini of fibrinogen chains end in globular domains, which are not completely equivalent. C terminal globular domains of the gamma chains (C-gamma) dimerize and bind to the GPR motif of the N-terminal domain of the alpha chain, while the GHR motif of N-terminal domain of the beta chain binds to the C terminal globular domains of another beta chain (C-beta), which leads to lattice formation.


The actual alignment was detected with superfamily member pfam00147:

Pssm-ID: 294064  Cd Length: 221  Bit Score: 348.36  E-value: 9.72e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   175 TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPtgtTEFWL 254
Cdd:pfam00147   1 FGRDCSDVYNKGAKTSGLYTIRPDGATKPFEVYCDMETDGGGWTVFQRRLDGSTNFKRNWKDYKAGFGNLSP---GEFWL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   255 GNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAgGDAGDAFDGFdfgddpsDKFFTSHN 334
Cdd:pfam00147  78 GNDKIHLLTKQG--PYVLRIDLEDWNGETVFALYDSFKVTNENDKYRLHVENYI-GDAGDALDTA-------GRSMTYHN 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   335 GMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKastpngyDNGIIWATWKTRWYSMKKTTMKIIP 414
Cdd:pfam00147 148 GMQFSTWDRDNDSPDGNCALSYGGGWWYNNCHAANLNGVYYYGGTYSK-------QNGIIWATWKGRWYSMKKAEMKIRP 220
Fib_alpha pfam08702
Fibrinogen alpha/beta chain family; Fibrinogen is a protein involved in platelet aggregation ...
31-172 8.29e-68

Fibrinogen alpha/beta chain family; Fibrinogen is a protein involved in platelet aggregation and is essential for the coagulation of blood. This domain forms part of the central coiled coiled region of the protein which is formed from two sets of three non-identical chains (alpha, beta and gamma).


:

Pssm-ID: 312286  Cd Length: 142  Bit Score: 212.40  E-value: 8.29e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    31 RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNmIDAATL 110
Cdd:pfam08702   1 AGGCCHLDEDFGVLCPTGCGIQDLLLKYERDVKKDLQKLENLLDDISNSTSSADELIKQIKDSLRERQKSSPD-NDNVYQ 79
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 70906439   111 KSRKMLE-EIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIH 172
Cdd:pfam08702  80 KSSSMLErRILYIKETIDTQESNIRVLQSILDSNRQKIQKLEQDIDQLERKCKEPCKDSVEIQ 142
 
Name Accession Description Interval E-value
Fibrinogen_C pfam00147
Fibrinogen beta and gamma chains, C-terminal globular domain;
175-414 9.72e-120

Fibrinogen beta and gamma chains, C-terminal globular domain;


Pssm-ID: 278572  Cd Length: 221  Bit Score: 348.36  E-value: 9.72e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   175 TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPtgtTEFWL 254
Cdd:pfam00147   1 FGRDCSDVYNKGAKTSGLYTIRPDGATKPFEVYCDMETDGGGWTVFQRRLDGSTNFKRNWKDYKAGFGNLSP---GEFWL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   255 GNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAgGDAGDAFDGFdfgddpsDKFFTSHN 334
Cdd:pfam00147  78 GNDKIHLLTKQG--PYVLRIDLEDWNGETVFALYDSFKVTNENDKYRLHVENYI-GDAGDALDTA-------GRSMTYHN 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   335 GMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKastpngyDNGIIWATWKTRWYSMKKTTMKIIP 414
Cdd:pfam00147 148 GMQFSTWDRDNDSPDGNCALSYGGGWWYNNCHAANLNGVYYYGGTYSK-------QNGIIWATWKGRWYSMKKAEMKIRP 220
FReD cd00087
Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is ...
174-415 2.59e-115

Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular arrangement called the disulfide knot. The C termini of fibrinogen chains end in globular domains, which are not completely equivalent. C terminal globular domains of the gamma chains (C-gamma) dimerize and bind to the GPR motif of the N-terminal domain of the alpha chain, while the GHR motif of N-terminal domain of the beta chain binds to the C terminal globular domains of another beta chain (C-beta), which leads to lattice formation.


Pssm-ID: 238040  Cd Length: 215  Bit Score: 336.91  E-value: 2.59e-115
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439 174 ITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSptgtTEFW 253
Cdd:cd00087   1 PLPRDCSEVLQRGGRTSGVYTIQPPGSNEPFQVYCDMDTDGGGWTVIQRRGDGSVDFYRSWKEYKDGFGNLD----GEFW 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439 254 LGNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFaGGDAGDAfdgfdfgddpsdkfFTSH 333
Cdd:cd00087  77 LGLEKIHLLTSQG--PYELRIDLEDWEGNTAYAEYDSFKVGSESEGYRLTLGGY-SGTAGDA--------------LSYH 139
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439 334 NGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGtyskasTPNGYDNGIIWATWKTRWYSMKKTTMKII 413
Cdd:cd00087 140 NGMKFSTFDRDNDGASGNCAESYSGGWWYNSCHASNLNGRYYSGG------HRNEYDNGINWATWKGSTYSLKFTEMKIR 213

                ..
gi 70906439 414 PF 415
Cdd:cd00087 214 PK 215
FBG smart00186
Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and ...
175-415 3.76e-108

Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and gamma chains, and a variety of fibrinogen-related proteins, including tenascin and Drosophila scabrous.


Pssm-ID: 214548  Cd Length: 212  Bit Score: 318.45  E-value: 3.76e-108
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    175 TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSptgtTEFWL 254
Cdd:smart00186   1 LPRDCSDVLQNGGKTSGLYTIYPDGSSRPLKVYCDMETDGGGWTVIQRRMDGSVDFYRDWKDYKEGFGNLA----GEFWL 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    255 GNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLtyayFAGGDAGDAFDGfdfgddpsdkFFTSHN 334
Cdd:smart00186  77 GNENIHLLTSQG--KYELRIDLEDWEGNTAYALYDSFKVADEADGYRL----HIGGYSGTAGDA----------SLTYHN 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    335 GMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQggtyskastPNGYDNGIIWATWKTRWYSMKKTTMKIIP 414
Cdd:smart00186 141 GMQFSTYDRDNDKYSGNCAEEYGGGWWYNNCHAANLNGRYYP---------NNNYDNGINWATWKGSWYSLKFTEMKIRP 211

                   .
gi 70906439    415 F 415
Cdd:smart00186 212 L 212
Fib_alpha pfam08702
Fibrinogen alpha/beta chain family; Fibrinogen is a protein involved in platelet aggregation ...
31-172 8.29e-68

Fibrinogen alpha/beta chain family; Fibrinogen is a protein involved in platelet aggregation and is essential for the coagulation of blood. This domain forms part of the central coiled coiled region of the protein which is formed from two sets of three non-identical chains (alpha, beta and gamma).


Pssm-ID: 312286  Cd Length: 142  Bit Score: 212.40  E-value: 8.29e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    31 RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNmIDAATL 110
Cdd:pfam08702   1 AGGCCHLDEDFGVLCPTGCGIQDLLLKYERDVKKDLQKLENLLDDISNSTSSADELIKQIKDSLRERQKSSPD-NDNVYQ 79
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 70906439   111 KSRKMLE-EIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIH 172
Cdd:pfam08702  80 KSSSMLErRILYIKETIDTQESNIRVLQSILDSNRQKIQKLEQDIDQLERKCKEPCKDSVEIQ 142
 
Name Accession Description Interval E-value
Fibrinogen_C pfam00147
Fibrinogen beta and gamma chains, C-terminal globular domain;
175-414 9.72e-120

Fibrinogen beta and gamma chains, C-terminal globular domain;


Pssm-ID: 278572  Cd Length: 221  Bit Score: 348.36  E-value: 9.72e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   175 TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPtgtTEFWL 254
Cdd:pfam00147   1 FGRDCSDVYNKGAKTSGLYTIRPDGATKPFEVYCDMETDGGGWTVFQRRLDGSTNFKRNWKDYKAGFGNLSP---GEFWL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   255 GNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAgGDAGDAFDGFdfgddpsDKFFTSHN 334
Cdd:pfam00147  78 GNDKIHLLTKQG--PYVLRIDLEDWNGETVFALYDSFKVTNENDKYRLHVENYI-GDAGDALDTA-------GRSMTYHN 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439   335 GMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKastpngyDNGIIWATWKTRWYSMKKTTMKIIP 414
Cdd:pfam00147 148 GMQFSTWDRDNDSPDGNCALSYGGGWWYNNCHAANLNGVYYYGGTYSK-------QNGIIWATWKGRWYSMKKAEMKIRP 220
FReD cd00087
Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is ...
174-415 2.59e-115

Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular arrangement called the disulfide knot. The C termini of fibrinogen chains end in globular domains, which are not completely equivalent. C terminal globular domains of the gamma chains (C-gamma) dimerize and bind to the GPR motif of the N-terminal domain of the alpha chain, while the GHR motif of N-terminal domain of the beta chain binds to the C terminal globular domains of another beta chain (C-beta), which leads to lattice formation.


Pssm-ID: 238040  Cd Length: 215  Bit Score: 336.91  E-value: 2.59e-115
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439 174 ITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSptgtTEFW 253
Cdd:cd00087   1 PLPRDCSEVLQRGGRTSGVYTIQPPGSNEPFQVYCDMDTDGGGWTVIQRRGDGSVDFYRSWKEYKDGFGNLD----GEFW 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439 254 LGNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFaGGDAGDAfdgfdfgddpsdkfFTSH 333
Cdd:cd00087  77 LGLEKIHLLTSQG--PYELRIDLEDWEGNTAYAEYDSFKVGSESEGYRLTLGGY-SGTAGDA--------------LSYH 139
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439 334 NGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGtyskasTPNGYDNGIIWATWKTRWYSMKKTTMKII 413
Cdd:cd00087 140 NGMKFSTFDRDNDGASGNCAESYSGGWWYNSCHASNLNGRYYSGG------HRNEYDNGINWATWKGSTYSLKFTEMKIR 213

                ..
gi 70906439 414 PF 415
Cdd:cd00087 214 PK 215
FBG smart00186
Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and ...
175-415 3.76e-108

Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and gamma chains, and a variety of fibrinogen-related proteins, including tenascin and Drosophila scabrous.


Pssm-ID: 214548  Cd Length: 212  Bit Score: 318.45  E-value: 3.76e-108
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    175 TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSptgtTEFWL 254
Cdd:smart00186   1 LPRDCSDVLQNGGKTSGLYTIYPDGSSRPLKVYCDMETDGGGWTVIQRRMDGSVDFYRDWKDYKEGFGNLA----GEFWL 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    255 GNEKIHLISTQSaiPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLtyayFAGGDAGDAFDGfdfgddpsdkFFTSHN 334
Cdd:smart00186  77 GNENIHLLTSQG--KYELRIDLEDWEGNTAYALYDSFKVADEADGYRL----HIGGYSGTAGDA----------SLTYHN 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    335 GMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQggtyskastPNGYDNGIIWATWKTRWYSMKKTTMKIIP 414
Cdd:smart00186 141 GMQFSTYDRDNDKYSGNCAEEYGGGWWYNNCHAANLNGRYYP---------NNNYDNGINWATWKGSWYSLKFTEMKIRP 211

                   .
gi 70906439    415 F 415
Cdd:smart00186 212 L 212
Fib_alpha pfam08702
Fibrinogen alpha/beta chain family; Fibrinogen is a protein involved in platelet aggregation ...
31-172 8.29e-68

Fibrinogen alpha/beta chain family; Fibrinogen is a protein involved in platelet aggregation and is essential for the coagulation of blood. This domain forms part of the central coiled coiled region of the protein which is formed from two sets of three non-identical chains (alpha, beta and gamma).


Pssm-ID: 312286  Cd Length: 142  Bit Score: 212.40  E-value: 8.29e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 70906439    31 RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNmIDAATL 110
Cdd:pfam08702   1 AGGCCHLDEDFGVLCPTGCGIQDLLLKYERDVKKDLQKLENLLDDISNSTSSADELIKQIKDSLRERQKSSPD-NDNVYQ 79
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 70906439   111 KSRKMLE-EIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIH 172
Cdd:pfam08702  80 KSSSMLErRILYIKETIDTQESNIRVLQSILDSNRQKIQKLEQDIDQLERKCKEPCKDSVEIQ 142
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH