NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|165905619|ref|NP_076220|]
View 

coiled-coil domain-containing protein 86 [Mus musculus]

Protein Classification

PTZ00249 family protein (domain architecture ID 13453771)

PTZ00249 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cgr1 pfam03879
Cgr1 family; Members of this family are coiled-coil proteins that are involved in pre-rRNA ...
302-388 1.60e-10

Cgr1 family; Members of this family are coiled-coil proteins that are involved in pre-rRNA processing.


:

Pssm-ID: 397798 [Multi-domain]  Cd Length: 107  Bit Score: 57.63  E-value: 1.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  302 PKGKPKSGRVWKDRSKKRFSQMVQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKQRRRQEKKERRAENLRRRLENERK 381
Cdd:pfam03879   1 PKGMRVSGKQWKAPKKAFRPFSGIVKKKLTSWEKRQEKRLELKAIKAKEKELKDEKEAERQRRIQAIKERRKAKEEKERY 80

                  ....*..
gi 165905619  382 AEIVQVI 388
Cdd:pfam03879  81 EELAAKM 87
PRK07764 super family cl35613
DNA polymerase III subunits gamma and tau; Validated
63-273 2.48e-05

DNA polymerase III subunits gamma and tau; Validated


The actual alignment was detected with superfamily member PRK07764:

Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 46.52  E-value: 2.48e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  63 QPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGP 142
Cdd:PRK07764 600 PPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPA 679
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 143 QPEASPGSPGPRQDADDGSPQRQPEPHPGslqphqdlglESPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEEVI 222
Cdd:PRK07764 680 APPPAPAPAAPAAPAGAAPAQPAPAPAAT----------PPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPP 749
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 165905619 223 PGSPEPCPGQQAPGPEP-SQPAQELTVQAPSSPERQLEPGKLPPAGETVTES 273
Cdd:PRK07764 750 DPAGAPAQPPPPPAPAPaAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDA 801
 
Name Accession Description Interval E-value
Cgr1 pfam03879
Cgr1 family; Members of this family are coiled-coil proteins that are involved in pre-rRNA ...
302-388 1.60e-10

Cgr1 family; Members of this family are coiled-coil proteins that are involved in pre-rRNA processing.


Pssm-ID: 397798 [Multi-domain]  Cd Length: 107  Bit Score: 57.63  E-value: 1.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  302 PKGKPKSGRVWKDRSKKRFSQMVQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKQRRRQEKKERRAENLRRRLENERK 381
Cdd:pfam03879   1 PKGMRVSGKQWKAPKKAFRPFSGIVKKKLTSWEKRQEKRLELKAIKAKEKELKDEKEAERQRRIQAIKERRKAKEEKERY 80

                  ....*..
gi 165905619  382 AEIVQVI 388
Cdd:pfam03879  81 EELAAKM 87
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
63-273 2.48e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 46.52  E-value: 2.48e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  63 QPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGP 142
Cdd:PRK07764 600 PPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPA 679
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 143 QPEASPGSPGPRQDADDGSPQRQPEPHPGslqphqdlglESPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEEVI 222
Cdd:PRK07764 680 APPPAPAPAAPAAPAGAAPAQPAPAPAAT----------PPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPP 749
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 165905619 223 PGSPEPCPGQQAPGPEP-SQPAQELTVQAPSSPERQLEPGKLPPAGETVTES 273
Cdd:PRK07764 750 DPAGAPAQPPPPPAPAPaAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDA 801
 
Name Accession Description Interval E-value
Cgr1 pfam03879
Cgr1 family; Members of this family are coiled-coil proteins that are involved in pre-rRNA ...
302-388 1.60e-10

Cgr1 family; Members of this family are coiled-coil proteins that are involved in pre-rRNA processing.


Pssm-ID: 397798 [Multi-domain]  Cd Length: 107  Bit Score: 57.63  E-value: 1.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  302 PKGKPKSGRVWKDRSKKRFSQMVQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKQRRRQEKKERRAENLRRRLENERK 381
Cdd:pfam03879   1 PKGMRVSGKQWKAPKKAFRPFSGIVKKKLTSWEKRQEKRLELKAIKAKEKELKDEKEAERQRRIQAIKERRKAKEEKERY 80

                  ....*..
gi 165905619  382 AEIVQVI 388
Cdd:pfam03879  81 EELAAKM 87
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
63-273 2.48e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 46.52  E-value: 2.48e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  63 QPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGP 142
Cdd:PRK07764 600 PPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPA 679
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 143 QPEASPGSPGPRQDADDGSPQRQPEPHPGslqphqdlglESPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEEVI 222
Cdd:PRK07764 680 APPPAPAPAAPAAPAGAAPAQPAPAPAAT----------PPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPP 749
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 165905619 223 PGSPEPCPGQQAPGPEP-SQPAQELTVQAPSSPERQLEPGKLPPAGETVTES 273
Cdd:PRK07764 750 DPAGAPAQPPPPPAPAPaAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDA 801
PHA03378 PHA03378
EBNA-3B; Provisional
64-314 1.49e-04

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 44.29  E-value: 1.49e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  64 PETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQ 143
Cdd:PHA03378 687 IQWAPGTMQPPPRAPTPMRPPAAPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARP 766
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 144 PEASPGSPGPRQDADDG-SPQRQPEPHPGSLQPHQDLglesPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEEVI 222
Cdd:PHA03378 767 PAAAPGAPTPQPPPQAPpAPQQRPRGAPTPQPPPQAG----PTSMQLMPRAAPGQQGPTKQILRQLLTGGVKRGRPSLKK 842
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 223 PGSPEPcPGQQAPGPEPSQPAQELTVQAPSSPERQLEPGKLPPAGETVTESlnlkkRVIASPQAPASKKLKEKEELPVIP 302
Cdd:PHA03378 843 PAALER-QAAAGPTPSPGSGTSDKIVQAPVFYPPVLQPIQVMRQLGSVRAA-----AASTVTQAPTEYTGERRGVGPMHP 916
                        250
                 ....*....|..
gi 165905619 303 KGKPKSGRVWKD 314
Cdd:PHA03378 917 TDIPPSKRAKTD 928
PRK03427 PRK03427
cell division protein ZipA; Provisional
143-296 1.92e-04

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 43.10  E-value: 1.92e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 143 QPEASPGSPGPRQdaddgSPQRQPEPHPGSLQPhqdlglESPAGQtesSPESPQREQPSKLPPPQGELDSEAAHAKEEVI 222
Cdd:PRK03427  74 APANAQEHEAARP-----SPQHQYQPPYASAQP------RQPVQQ---PPEAQVPPQHAPRPAQPAPQPVQQPAYQPQPE 139
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 165905619 223 PGSPEPCPGQQAPGPEPSQPAQELTVQAPSSPERQLEPGKLPPAgetvteslnlkkrviasPQAPASKKLKEKE 296
Cdd:PRK03427 140 QPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVA-----------------EPAPVMDKPKRKE 196
PHA03247 PHA03247
large tegument protein UL36; Provisional
68-266 2.51e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 43.39  E-value: 2.51e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619   68 PGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPEAS 147
Cdd:PHA03247 2751 PGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPP 2830
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  148 PGSPGPRQDADDGSPQRQPEPHPGSLQPHQDLGLESPAGQTESSPESPQREQPSKL--PPPQGELDSEAAHAKEEVIPGS 225
Cdd:PHA03247 2831 PTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLarPAVSRSTESFALPPDQPERPPQ 2910
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 165905619  226 PEPCPGQQAPGPEPSQPAQELTVQAPSSPERQLEPGKLPPA 266
Cdd:PHA03247 2911 PQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
PTZ00249 PTZ00249
variable surface protein Vir28; Provisional
153-269 1.44e-03

variable surface protein Vir28; Provisional


Pssm-ID: 140276  Cd Length: 516  Bit Score: 40.79  E-value: 1.44e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 153 PRQDADDGSPQRQPEPHPGSLQPHQDLGLESPA-GQTESSPESPQREQPSKLP-----PPQGELDS-EAAHAKEEVIP-G 224
Cdd:PTZ00249 288 PSSKAHDRNPVQTPTPTSVSGYSSQAKGLEKQAgGESERTSSVPSEQFPLPLPvllplGQSGPLESsESEETDEYAGPkG 367
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 165905619 225 SPEPCPGQQapgpEPSQPAQELTVQAPSSPERQLEPGKL-----PPAGET 269
Cdd:PTZ00249 368 LPEPELELV----ELQEEDQRHGLKHDVDTFREDEEDTFlqegdQPAGSM 413
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
146-279 2.20e-03

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 39.96  E-value: 2.20e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 146 ASPGSPGPRQDADDGSPQRQPEPHPGSLQPHQDLGLESPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEE----- 220
Cdd:PRK13108 315 VGPVGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRDGESTPAVEETSEADIEREQPGDLAGQAPAAHQVdaeaa 394
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 165905619 221 -VIPGSPEPCPGQQAPGPEPSQPAQELTVQAPSSPERQL--EPGKLP--PAGETVTESLNLKKR 279
Cdd:PRK13108 395 sAAPEEPAALASEAHDETEPEVPEKAAPIPDPAKPDELAvaGPGDDPaePDGIRRQDDFSSRRR 458
PRK03427 PRK03427
cell division protein ZipA; Provisional
123-248 2.48e-03

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 39.63  E-value: 2.48e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 123 QPETSPGSPCPPLSLPSPGPQPEASPGSPGPRQDADDGSPQRQPEPHP--GSLQPHQDLGLESPAGQTESSPESPQREQP 200
Cdd:PRK03427  74 APANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPRPaqPAPQPVQQPAYQPQPEQPLQQPVSPQVAPA 153
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 165905619 201 SKLPPPQGELDSEAAHAKEEVIPGSPEPcpgQQAPGPEPSQPAQELTV 248
Cdd:PRK03427 154 PQPVHSAPQPAQQAFQPAEPVAAPQPEP---VAEPAPVMDKPKRKEAV 198
dnaA PRK14086
chromosomal replication initiator protein DnaA;
63-260 4.05e-03

chromosomal replication initiator protein DnaA;


Pssm-ID: 237605 [Multi-domain]  Cd Length: 617  Bit Score: 39.42  E-value: 4.05e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  63 QPETSPGSPCPPLSLPSPGPQPETSPGspcpplSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGP 142
Cdd:PRK14086  96 APPPPHARRTSEPELPRPGRRPYEGYG------GPRADDRPPGLPRQDQLPTARPAYPAYQQRPEPGAWPRAADDYGWQQ 169
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 143 QPEASPGSPGPRQDADDGSPQRQPEPHPGSLQPHQDLGLESPAGQTESSPESPQREQPSKLPPPQGELDSEAAHAKEEVi 222
Cdd:PRK14086 170 QRLGFPPRAPYASPASYAPEQERDREPYDAGRPEYDQRRRDYDHPRPDWDRPRRDRTDRPEPPPGAGHVHRGGPGPPER- 248
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 165905619 223 PGSPEPCPGQQAPGPEPSQPAqelTVQAPSSPERQLEP 260
Cdd:PRK14086 249 DDAPVVPIRPSAPGPLAAQPA---PAPGPGEPTARLNP 283
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
39-255 6.69e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 38.81  E-value: 6.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619  39 SNSEETGELKSTRVPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCPPLSLP 118
Cdd:PRK07764 596 GGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGG 675
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 165905619 119 SPGPQPETSPgspcpplslpspGPQPEASPGSPGPRQDADDGSPQRQPEPHPGSLQPHQDLGLESPAGQTESSPESPQRE 198
Cdd:PRK07764 676 AAPAAPPPAP------------APAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPP 743
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 165905619 199 QPSKLPPPQGELDSEAAHakeeviPGSPEPCPGQQAPGPEPSQPAQELTVQAPSSPE 255
Cdd:PRK07764 744 EPDDPPDPAGAPAQPPPP------PAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMD 794
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH