NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|84579880|ref|NP_076397|]
View 

solute carrier organic anion transporter family member 3A1 isoform 1 [Mus musculus]

Protein Classification

solute carrier organic anion transporter (domain architecture ID 13024459)

solute carrier organic anion transporter is a major facilitator superfamily (MFS) transporter that mediates the Na(+)-independent high affinity transport of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, and the thyroid hormones thyroxine and triiodothyronine, among others

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
39-563 0e+00

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


:

Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 845.75  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17402   1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKyeageirwgaegrdvcatngsssdegpdpdlicrnrtaTNMMYLLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17402  81 GALLSALPEFLTHQYK--------------------------------------TNMMYLLLIGAQVLLGIGATPVQPLG 122
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17402 123 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFS 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQSLpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfQQLRVIPKVTKHLLSNPVFTCIVLAA 358
Cdd:cd17402 203 ALLMFGFPQSL-------------------------------------------QQLRVIPKVTKHLLSNPVFTCIVLAA 239
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17402 240 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 319
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPPE 518
Cdd:cd17402 320 LFLGCDTGPVAGVTVPYGNDTAPGSSLDPYAPCNSNCECQTDSFSPVCGADGITYLSACFAGCSSTNLSGCACLSSVPAE 399
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 84579880 519 NASVVPGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17402 400 NATVVPGKCPSPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
 
Name Accession Description Interval E-value
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
39-563 0e+00

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 845.75  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17402   1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKyeageirwgaegrdvcatngsssdegpdpdlicrnrtaTNMMYLLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17402  81 GALLSALPEFLTHQYK--------------------------------------TNMMYLLLIGAQVLLGIGATPVQPLG 122
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17402 123 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFS 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQSLpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfQQLRVIPKVTKHLLSNPVFTCIVLAA 358
Cdd:cd17402 203 ALLMFGFPQSL-------------------------------------------QQLRVIPKVTKHLLSNPVFTCIVLAA 239
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17402 240 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 319
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPPE 518
Cdd:cd17402 320 LFLGCDTGPVAGVTVPYGNDTAPGSSLDPYAPCNSNCECQTDSFSPVCGADGITYLSACFAGCSSTNLSGCACLSSVPAE 399
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 84579880 519 NASVVPGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17402 400 NATVVPGKCPSPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
41-619 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 608.05  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880    41 IFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGA 120
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   121 LLSALPEFLthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmYLLLIGAQVLLGIGATPVQPLGVS 200
Cdd:pfam03137  81 LLFALPHFL-----------------------------------------------SGPFFLGQLLLGIGGTPLYTLGIS 113
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   201 YIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDavfIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSL 280
Cdd:pfam03137 114 YIDDNVKKKNSPLYIGILYAVRVLGPALGFLLGSLCLRIYVD---IGSVSLTLTPKDPRWVGAWWLGFLIAGLLLLLTAI 190
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   281 LMFGFPQSLPphsdpGMESEQAMlpereyERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIVLAACM 360
Cdd:pfam03137 191 PFFFFPKSLP-----GTAKRRAE------KKKERESHHSIKDKEKTKSLKLGKSLKDFPKALKRLLKNPVYMLLTLASVS 259
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   361 EIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLF 440
Cdd:pfam03137 260 EFLLIAGYATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLVSLLLSLLLFF 339
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   441 LGCDTGPVAGVTVRYGNNSARGSALdpYSPCNNNCECQTDSFTPVCGADGITYLSACFAGC-----------NSTNLTGC 509
Cdd:pfam03137 340 LGCPNSPVAGITVPYGGTQQLSGNL--TASCNSNCSCSSSFYSPVCGSDGIGYTSPCPCGAgcssssgagksTYNCSCCC 417
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   510 ACLTTVPPENASVVPGKCPSPgCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPP 589
Cdd:pfam03137 418 SCGSSDSGGNGSATPGKCPSD-CSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLILRLLGFIPG 496
                         570       580       590
                  ....*....|....*....|....*....|
gi 84579880   590 PLIFGAGIDSTCLFWSTFCGEQGACVLYDN 619
Cdd:pfam03137 497 PIIFGALIDSTCLLWTKTCGGRGNCWLYDN 526
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
34-650 1.30e-152

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 456.88  E-value: 1.30e-152
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880    34 SCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGG 113
Cdd:TIGR00805  26 SLFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGC 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   114 IVMALGALLSALPEFLTHQYKYEAGEIRWG---AEGRDVCATNGSSSDEGPDPDLICRNRTATNMMYLLLIGaQVLLGIG 190
Cdd:TIGR00805 106 AIMGLGSLLSSLPHFLMGRYSYSTTVSSTGnlsSANSFLCMENLTQTLRPTQDPSECQKQHKSLMWLLFLVS-NILRGIG 184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   191 ATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLL 270
Cdd:TIGR00805 185 ATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWIGFLV 264
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   271 CGALLFFSSLLMFGFPQSLPPHS--DPGMESEQAMLPEREYERPKPSNGVLRHplepdssascfqqlrvIPKVTKHLLSN 348
Cdd:TIGR00805 265 CGFVALLTSIPLFFFPKTLPKEGkrVNVDVHEAEKLEKSRGEDRKKNSGITKD----------------FPKFIKRLLCN 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   349 PVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVN 428
Cdd:TIGR00805 329 KIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAYFAICLS 408
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   429 LVSTACYVSFLFLGCDTGPVAGVTvrygNNSARGSaLDPYSP--CNNNCECQTDSFTPVCGADGITYLSACFAGCNST-- 504
Cdd:TIGR00805 409 TLEYLLYSPKFLITCESAPVAGVN----NPSNDQP-LYVENRtdCNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRMSvg 483
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   505 -----NLTGCACLTTvpPENASVVPGKCPSPgCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLFL 579
Cdd:TIGR00805 484 tgsnmVFTNCSCIQT--PGNSSAKKGLCDPP-CATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLGLGLQWF 560
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 84579880   580 LLRLLGFIPPPLIFGAGIDSTCLFWSTFC-GEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLRK 650
Cdd:TIGR00805 561 CIRVFGTIPAPILFGALIDVTCLHWQTLKcGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
471-503 2.04e-03

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


Pssm-ID: 197624  Cd Length: 46  Bit Score: 36.50  E-value: 2.04e-03
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 84579880    471 CNNNCecqTDSFTPVCGADGITYLSACF---AGCNS 503
Cdd:smart00280   2 CPEAC---PREYDPVCGSDGVTYSNECHlckAACES 34
 
Name Accession Description Interval E-value
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
39-563 0e+00

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 845.75  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17402   1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKyeageirwgaegrdvcatngsssdegpdpdlicrnrtaTNMMYLLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17402  81 GALLSALPEFLTHQYK--------------------------------------TNMMYLLLIGAQVLLGIGATPVQPLG 122
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17402 123 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFS 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQSLpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfQQLRVIPKVTKHLLSNPVFTCIVLAA 358
Cdd:cd17402 203 ALLMFGFPQSL-------------------------------------------QQLRVIPKVTKHLLSNPVFTCIVLAA 239
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17402 240 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 319
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPPE 518
Cdd:cd17402 320 LFLGCDTGPVAGVTVPYGNDTAPGSSLDPYAPCNSNCECQTDSFSPVCGADGITYLSACFAGCSSTNLSGCACLSSVPAE 399
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 84579880 519 NASVVPGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17402 400 NATVVPGKCPSPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
41-619 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 608.05  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880    41 IFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGA 120
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   121 LLSALPEFLthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmYLLLIGAQVLLGIGATPVQPLGVS 200
Cdd:pfam03137  81 LLFALPHFL-----------------------------------------------SGPFFLGQLLLGIGGTPLYTLGIS 113
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   201 YIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDavfIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSL 280
Cdd:pfam03137 114 YIDDNVKKKNSPLYIGILYAVRVLGPALGFLLGSLCLRIYVD---IGSVSLTLTPKDPRWVGAWWLGFLIAGLLLLLTAI 190
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   281 LMFGFPQSLPphsdpGMESEQAMlpereyERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIVLAACM 360
Cdd:pfam03137 191 PFFFFPKSLP-----GTAKRRAE------KKKERESHHSIKDKEKTKSLKLGKSLKDFPKALKRLLKNPVYMLLTLASVS 259
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   361 EIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLF 440
Cdd:pfam03137 260 EFLLIAGYATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLVSLLLSLLLFF 339
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   441 LGCDTGPVAGVTVRYGNNSARGSALdpYSPCNNNCECQTDSFTPVCGADGITYLSACFAGC-----------NSTNLTGC 509
Cdd:pfam03137 340 LGCPNSPVAGITVPYGGTQQLSGNL--TASCNSNCSCSSSFYSPVCGSDGIGYTSPCPCGAgcssssgagksTYNCSCCC 417
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   510 ACLTTVPPENASVVPGKCPSPgCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPP 589
Cdd:pfam03137 418 SCGSSDSGGNGSATPGKCPSD-CSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLILRLLGFIPG 496
                         570       580       590
                  ....*....|....*....|....*....|
gi 84579880   590 PLIFGAGIDSTCLFWSTFCGEQGACVLYDN 619
Cdd:pfam03137 497 PIIFGALIDSTCLLWTKTCGGRGNCWLYDN 526
MFS_SLCO_OATP cd17336
Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; ...
39-563 1.05e-152

Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; Solute carrier organic anion transporters (SLCOs) are also called organic anion transporting polypeptides (OATPs) or SLC21 (Solute carrier family 21) proteins. They are sodium-independent transporters that mediate the transport of a broad range of endo- as well as xenobiotics. Their substrates are mainly amphipathic organic anions with a molecular weight of more than 300Da, although there are a few known neutral or positively charged substrates. These include drugs including statins, angiotensin-converting enzyme inhibitors, angiotensin receptor blockers, antibiotics, antihistaminics, antihypertensives, and anticancer drugs. SLCOs/OATPs can be classified into 6 families (SLCO1-6 or OATP1-6) and each family may have subfamilies (e.g. OATP1A, OATP1B, OATP1C). Within the subfamilies, individual members are numbered according to the chronology of their identification and if there is already an ortholog known, they are given the same number. For example, the first SLCO identified, is rat OATP1A1 (encoded by the Slco1a1 gene). The second SLCO identified is the first human SLCO from the same subfamily and is called OATP1A2 (encoded by the SLCO1A2 gene). There are 11 human SLCOs/OATPs. SLCOs belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340894 [Multi-domain]  Cd Length: 411  Bit Score: 449.00  E-value: 1.05e-152
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17336   1 PKVFVVLLCLLGLLQGAVVSYFVSTITTIEKRFGLSSSQSGLILSANDIGQLLAVLLVSYFGGRGHRPRWIGIGSILMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmylllIGAQVLLGIGATPVQPLG 198
Cdd:cd17336  81 GCFLLALPHFL---------------------------------------------------FVGQFLLGIGSSPLYTLG 109
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSnldITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17336 110 ITYIDDNVSKKNSPLYIGILYAMRVLGPALGFLLGSFLLRIYVDFSRVPLG---ITPDDPRWIGAWWLGFLILGILLLIV 186
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPqslpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkhllsnPVFTCIVLAA 358
Cdd:cd17336 187 SIPLFFFP--------------------------------------------------------------PIFILLLLAI 204
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17336 205 VFESFAISGFSTFLPKYLETQFRLSASLASLLTGLILVPGAALGILLGGLIIKKFKLTARGLAKFVLILSLLSVILYISL 284
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYGNNSArgsalDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGC-------NSTNLTGCAC 511
Cdd:cd17336 285 FFLGCDNPPIAGVTTPYGSSSS-----PITSSCNSDCNCSDSSFSPVCGSDGITYFSPCHAGCtssdagnGTKTYSNCSC 359
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|..
gi 84579880 512 LTTVPPENASVVPGKCPSPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17336 360 INSGTATSSGCPPDCSVAPNCCSKLIPFLAVLFLSSFLLSLSIVPSTMITLR 411
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
34-650 1.30e-152

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 456.88  E-value: 1.30e-152
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880    34 SCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGG 113
Cdd:TIGR00805  26 SLFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGC 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   114 IVMALGALLSALPEFLTHQYKYEAGEIRWG---AEGRDVCATNGSSSDEGPDPDLICRNRTATNMMYLLLIGaQVLLGIG 190
Cdd:TIGR00805 106 AIMGLGSLLSSLPHFLMGRYSYSTTVSSTGnlsSANSFLCMENLTQTLRPTQDPSECQKQHKSLMWLLFLVS-NILRGIG 184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   191 ATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLL 270
Cdd:TIGR00805 185 ATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWIGFLV 264
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   271 CGALLFFSSLLMFGFPQSLPPHS--DPGMESEQAMLPEREYERPKPSNGVLRHplepdssascfqqlrvIPKVTKHLLSN 348
Cdd:TIGR00805 265 CGFVALLTSIPLFFFPKTLPKEGkrVNVDVHEAEKLEKSRGEDRKKNSGITKD----------------FPKFIKRLLCN 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   349 PVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVN 428
Cdd:TIGR00805 329 KIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAYFAICLS 408
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   429 LVSTACYVSFLFLGCDTGPVAGVTvrygNNSARGSaLDPYSP--CNNNCECQTDSFTPVCGADGITYLSACFAGCNST-- 504
Cdd:TIGR00805 409 TLEYLLYSPKFLITCESAPVAGVN----NPSNDQP-LYVENRtdCNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRMSvg 483
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   505 -----NLTGCACLTTvpPENASVVPGKCPSPgCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLFL 579
Cdd:TIGR00805 484 tgsnmVFTNCSCIQT--PGNSSAKKGLCDPP-CATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLGLGLQWF 560
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 84579880   580 LLRLLGFIPPPLIFGAGIDSTCLFWSTFC-GEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLRK 650
Cdd:TIGR00805 561 CIRVFGTIPAPILFGALIDVTCLHWQTLKcGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
MFS_SLCO5_OATP5 cd17404
Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of ...
40-563 2.94e-133

Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 5 (SLCO5) or Organic anion transporting polypeptide 5 (OATP5) family contains only one subfamily, OATP5A, which contains only one mammalian member OATP5A1 (encoded by SLCO5A1). Deletion of the SLCO5A1 gene has been implicated in the pathogenesis of Mesomelia-synostoses syndrome (MSS), a rare autosomal-dominant disorder characterized by mesomelic limb shortening, acral synostoses, and multiple congenital malformations. OATP5A1 may be a non-classical OATP which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration. It seems to affect intracellular transport of drugs and may participate in chemoresistance of small cell lung cancer (SCLC by sequestration), rather than mediating cellular uptake. The SLCO5/OATP5 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340962 [Multi-domain]  Cd Length: 425  Bit Score: 399.81  E-value: 2.94e-133
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  40 KIFLVSECALMLAQGT-VGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17404   1 KAFLVCMCLLIFIQSAlSSGYLNSVITTIEKRYSLKSSESGLIVSSYEIGSLLTVVFVSYFGGRGHRPRWIAVGGVLIAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmylllIGAQVLLGIGATPVQPLG 198
Cdd:cd17404  81 GSFLFSLPHFF---------------------------------------------------ILAQILIGMGGTPIFTLG 109
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVfidTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17404 110 TTYLDDHVKKESSSLYLAIMYVMGALGPAAGFLLGGLLINFYVDPL---STPPDISPGDPRWIGAWWGGFLLCGIALLLV 186
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQslpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkhllsnPVFTCIVLAA 358
Cdd:cd17404 187 AFPFFTFPK-------------------------------------------------------------MTFLVVSLGY 205
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17404 206 CMELAIVSGFITFLPKYLETQFGIPASNANIFTGVIAVPGAGIGIVLGGYILKRFKLGPKGAAKLALICNFLSLLLFLTL 285
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYGNNSARGSAL--DPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNS--------TNLTG 508
Cdd:cd17404 286 FFLGCESIKLAGITIPYTTGPSLSSTHgrNLTSECNVNCGCSINEYEPVCGSDGITYFSPCLAGCTSvgntstgiRNYTN 365
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 84579880 509 CACLTT----VPPENASVV---PGKCPSPgCQeAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17404 366 CACLQSrssiSPPTVGQGSqlqAGPCSRT-CN-TLIPFLILLFIVTLITACAQMPALMITLR 425
MFS_SLCO2A_OATP2A cd17461
Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of ...
38-563 2.58e-120

Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2A (SLCO2A), also called Organic anion-transporting polypeptide 2A (OATP2A), subfamily has one mammalian member, OATP2A1 (encoded by SLCO2A1), which is also called prostaglandin transporter. It is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Mutations in SLCO2A1 can cause primary hypertrophic osteoarthropathy (PHO), a rare multi-organic disease characterized by digital clubbing, pachydermia and periosteal reaction. The SLCO2A/OATP2A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341019 [Multi-domain]  Cd Length: 474  Bit Score: 368.36  E-value: 2.58e-120
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  38 NIKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMA 117
Cdd:cd17461   1 NIKVFVLCHGLLQLSQLLYSAYFKSSLTTIEKRFGLSSLSSGLISSLHEIGNAVLIIFVSYFGSRVHRPRLIGIGGLLLA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 118 LGALLSALPEFLTHQYKYEageirwgaegrdvcatngsssdegpdpdlicrnrtatnmMYLLLIGAQVLLGIGATPVQPL 197
Cdd:cd17461  81 LGAFLLTLPHFLSEPYQYS---------------------------------------MWVLMVVAQLLAGIGTVPIQPF 121
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 198 GVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFF 277
Cdd:cd17461 122 GISYVDDFAEPSNSPLYIAILFAISVFGPAFGYLLGSVVLRIFVDIGRVNTATVELTPADPRWIGAWWLGLLISSGLLVL 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 278 SSLLMFGFPQSLPPHSDPGmeSEQAMLpeREYERPKPSNGvlrhplepdssaSCFQQLRVIPKVTKHLLSNPVFTCIVLA 357
Cdd:cd17461 202 TSLPYFFFPREMLVGKKPS--PEGDML--RKKEDEKKEEG------------SLLDFIKRFPKMFVKLLLNPLFMLLVLA 265
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 358 ACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVS 437
Cdd:cd17461 266 QCTFSSVIAGLSTFLNKFLEKQYGASASYANFLIGAVNLPAAALGMLLGGIIMKRFGFSLRAIPRFSVVILSISIMLCVP 345
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 438 FLFLGCDTGPVAGVTVRYGNnsargSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLT---------- 507
Cdd:cd17461 346 LFFMGCSTQDVAGVYPKTSN-----SSDGPHLSCSANCSCPESAFNPVCGENGIEYISPCHAGCTNSNMDsstyrqqiys 420
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 84579880 508 GCACLTTVPPENaSVVPGKCPSPgCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17461 421 NCSCIPDLSGEK-PAKTGSCPNS-CSHLLLPVMFLISFAGLIACLTHNPLYMMVLR 474
MFS_SLCO1A_OATP1A cd17458
Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of ...
39-564 7.10e-120

Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1A (SLCO1A), also called Organic anion-transporting polypeptide 1A (OATP1A), subfamily is composed of one human member OATP1A2 (encoded by SLCO1A2) and several rodent proteins encoded by the Slco1a1, Slco1a3, Slco1a4, Slco1a5, and Slco1a6 genes. OATP1A2, also known as human OATP-A or OATP1, shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). It is expressed in the brain, kidney, intestine, liver, lung, testes, and the eye (ciliary body). The SLCO1A/OATP1A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341016 [Multi-domain]  Cd Length: 527  Bit Score: 368.80  E-value: 7.10e-120
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17458   2 LKIFLLALSYAYVAKTLSGAYMNSMITQIERRFNIPSSLVGIINGSFEIGNLLVIAFVSYFGAKLHRPKVIGLGCLIMSL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKYEAGEIRWGAEGRDV--CATNGSSSDEGPDPDLICrNRTATNMMYLLLIGAQVLLGIGATPVQP 196
Cdd:cd17458  82 GCFLASLPHFLMGRYEYESTVSTTSNSSSRVplCLANQSLSHNVTQLPSEC-EKESMSLMWIFVLVGNLLRGIGETPVMP 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 197 LGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLF 276
Cdd:cd17458 161 LGISYIDDFSKKENSPFYIGCLHTATIVGPLLGLLLASFCAQLYVDLGSVNADDLTITPTDIRWVGAWWLGFLICAGVNF 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 277 FSSLLMFGFPQSLPPHSDpgmeseqamlpEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIVL 356
Cdd:cd17458 241 LAGLPFWFLPKSLPKEGE-----------ENETEPSKTLTVELEENKGQETKQEMYEIAKDFLPFLKSLFRNPIYMLFII 309
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 357 AACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYV 436
Cdd:cd17458 310 VTVLQFNAFSGMISFMPKYLEQQYGKSASDAIFLIGVYNLPIICLGYFFGGLYMKKFKINTYQAAHIGFWVSLLEYLLYF 389
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 437 SFLFLGCDTGPVAGVTVRYGNNSARGSAL-DPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTG------- 508
Cdd:cd17458 390 SAFWMGCDNSPVAGLTVSYEGIDQDSYYEnTLLADCNRDCDCPLKVWDPVCGNNGLTYVSACLAGCKASVGTGknmvfqn 469
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 84579880 509 CACLTTVP-PENASVVPGKCP-SPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIRT 564
Cdd:cd17458 470 CSCVAASGfPSQNSSAVGQCDkGETCDKMLQYFLILSLVCSFIFSLAAMPGYMVLIRS 527
MFS_SLCO1C_OATP1C cd17459
Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of ...
39-563 1.61e-119

Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1C (SLCO1C), also called Organic anion-transporting polypeptide 1C (OATP1C), subfamily contains one mammalian member, OATP1C1 (encoded by SLCO1C1), which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine), as well as organic anions such as 17-beta-glucuronosyl estradiol, estrone-3-sulfate, and sulfobromophthalein (BSP), which are transported with much lower efficiency. The SLCO1C/OATP1C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341017 [Multi-domain]  Cd Length: 498  Bit Score: 366.79  E-value: 1.61e-119
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17459   1 LKIFLAALSFAYFAKALSGSYMKSTITQIERRFDIPSSLIGVIDGSFEMGNLLVIAFVSYFGAKLHRPRIIGAGCLLMAI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKYEAGEIRWGAEGRDVCATNGSSSDEGPDPDLI-------CRNRTATNMMYLLLIGaQVLLGIGA 191
Cdd:cd17459  81 GTFLIALPHFFMGRYKYETAIQSSSNSTVSISPCSLEPSPQLHSIESSdsktgtgCEKEPGSSMWIYVFLG-NLLRGIGE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 192 TPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLC 271
Cdd:cd17459 160 TPVQPLGISYIDDFAKEENAAFYIGCVQTIAIIGPVFGFLLGSLCAKLYVDIGFVNLDSITITPKDARWVGAWWLGYLIA 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 272 GALLFFSSLLMFGFPQSLPPHSDPGMeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtKHLLSNPVF 351
Cdd:cd17459 240 GVITLLSAVPFWFLPKSLPKDFLPSL---------------------------------------------KNLLGNPVY 274
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 352 TCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVS 431
Cdd:cd17459 275 FLYLCTSILQFNSLIGMVTYKPKYIEQQYGQSASKANFLIGLINIPAVAIGIFSGGLLMKKFKLSVIGAAKLSFGTSFFG 354
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 432 TACYVSFLFLGCDTGPVAGVTVRY-GNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTG-- 508
Cdd:cd17459 355 YLLLLSFFAMGCENSDVAGLTVSYnGTKQVSYADRSLFSQCNADCKCSQKDWDPVCGENGITYVSPCLAGCKASNGSGkn 434
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 84579880 509 -----CACLTTVPPE--NASVVPGKCP-SPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17459 435 tvfhnCSCIGIPSSAsgSSSAILGQCPkGNACARMFLYFLAISVISSFTLSLGGTPGYILLIR 497
MFS_SLCO2B_OATP2B cd17460
Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of ...
39-563 7.49e-119

Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2B (SLCO2B), also called Organic anion-transporting polypeptide 2B (OATP2B), subfamily has one mammalian member, OATP2B1 (encoded by SLCO2B1). It mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. It also mediates the transport of endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). SLCO2B1 variations result in differential expression and uptake of DHEAS, which impacts subsequent resistance to androgen-deprivation therapy (ADT), the primary treatment of metastatic prostate cancer. The SLCO2B/OATP2B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341018 [Multi-domain]  Cd Length: 479  Bit Score: 364.48  E-value: 7.49e-119
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17460   1 IKFFVLCHGLLQLSQLLVSGYLKSSISTIEKRFGLSSQTSGLLASFNEVGNTVLIVFVSYFGSRVHRPRFIGCGAILVSL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKYeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmyLLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17460  81 AGFLMALPHFISEPYEY------------------------------------------GILFLGQLLLGIGGVPIQPFG 118
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17460 119 ISYIDDFASESNSPLYLGILFAVTVLGPGFGFMLGSAMLRFYVDIDKMSEDEISLEIGDPRWVGAWWLGFLIAATLVALS 198
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQSLPphsdpgmeSEQAMLPEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIVLAA 358
Cdd:cd17460 199 AVPYFFFPREMP--------KEVVELQPREKKLAKTMLKKLKSLSDILQNLSLLQFIKKFPRILLRTLRNPIYLLVVLAQ 270
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17460 271 VNLSAMVAGLATFMGKFLERQFSITASFANLMIGGLNIPSAMVGIVVGGVILKRLQLTVRGCGAMCVLGMLLCLFFALPL 350
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYgnNSARGSALDPysPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNL----------TG 508
Cdd:cd17460 351 LFIGCSTQKIAGITHRT--SSSPGLELSS--QCSEACSCPPEAFNPVCGSDGVEYISPCHAGCKSVNVqaldnsvvnyTD 426
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*
gi 84579880 509 CACLTTVPPENASvVPGKCPSpGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17460 427 CSCVSEGGPVGAA-SPGTCGS-GCSHLLVPFMLLVSLGGFLASLSHTPSFMLILR 479
MFS_SLCO4_OATP4 cd17403
Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of ...
39-563 1.73e-114

Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4 (SLCO4) or Organic anion transporting polypeptide 4 (OATP4) family contains two families: OATP4A and OATP4C, each containing one mammalian member, OATP4A1 and OATP4C1, respectively. OATP4A1 (encoded by SLCO4A1), is ubiquitously expressed and mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4C1 (encoded by SLCO4C1) is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate, cAMP, and uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs). The SLCO4/OATP4 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340961 [Multi-domain]  Cd Length: 420  Bit Score: 351.17  E-value: 1.73e-114
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSV-LTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMA 117
Cdd:cd17403   1 PKGFLFFLCIFAFLQGMVVNGFVNVsITTIEKRFGLTSTQTGLIASSYDIASVLLLLFVSYFGGRGHKPRWLGIGAFIMG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 118 LGALLSALPEFLthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmylLLIGAQVLLGIGATPVQPL 197
Cdd:cd17403  81 IGSLVFALPHFT-------------------------------------------------VFILAQLLHGAGATPLYTL 111
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 198 GVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDaVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFF 277
Cdd:cd17403 112 GVTYLDENVSTKMSPLYIGIFYAMAILGPAIGYVLGGFLLNLYTD-IDQVDSELGLTPDDPRWVGAWWLGFLISGALALI 190
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 278 SSLLMFGFPqslpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkhllsnPVFTCIVLA 357
Cdd:cd17403 191 IAFPLLGFP--------------------------------------------------------------PTFMFLNLA 208
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 358 ACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACyVS 437
Cdd:cd17403 209 GASEGMLLAGFATFLPKLIESQFSLSASLAALLVGVVVVPGGILGTFLGGLIVKKLKLKCKGILKFCIVCSIVAFLF-SF 287
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 438 FLFLGCDTGPVAGVTVRYGNNSARGSaLDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGC-------NSTNLTGCA 510
Cdd:cd17403 288 ILLIYCPNAPFAGVTVPYGNSPLEGT-SNLTSTCNADCHCSEDFYDPVCGSDGVTYYSPCHAGCttshgddGQKVYSNCS 366
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*
gi 84579880 511 CLTTVPPENASVVPGKCP--SPGCQEAFLtFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17403 367 CIQSNSSKTSTAATGKACpcETCCQKLYL-FLAVFFLLIVFTFMSSTPALSATLR 420
MFS_SLCO1B_OATP1B cd17457
Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of ...
39-563 3.29e-110

Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1B (SLCO1B), also called organic anion-transporting polypeptide 1B (OATP1B), subfamily is composed of two human proteins, OATP1B1 (encoded by SLCO1B1) and OATP1B3 (encoded by SLCO1B3), and one rodent member, OATP1B2 (encoded by Slco1b2). OATP1B1 and OATP1B3 are almost exclusively expressed on the basal side of hepatocytes in normal human organs. They both can accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). Loss-of-function mutations in both SLCO1B1 and SLCO1B3 genes result in the Rotor syndrome, a hereditary hyperbilirubinemia. The SLCO1B/OATP1B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341015 [Multi-domain]  Cd Length: 455  Bit Score: 341.44  E-value: 3.29e-110
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17457   1 LKMFLAALSFSYFAKALSGIIMKSSITQIERRFDISSSTVGFIDGSFEIGNLLVIAFVSYFGAKLHRPKLIAAGCFIMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKYEageirwgaegrdvCATNGSSsdegpdpdlicrnrtatnMMYLLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17457  81 GSVLTALPHFFMGYYKYG-------------CLKESGS------------------YMWVYVLMGNMLRGIGETPIVPLG 129
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17457 130 ISYLDDFAKEENSPLYLACLHTIAMIGPMIGFTLGSLFAKLYVDIGFVDLSTIRITPQDSRWVGAWWLGFLVSGLFSIIS 209
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPqslpphsdpgmeseqamlpereyerpkpsngvlrhplepdssaSCFQQLrvipkvtKHLLSNPVFTCIVLAA 358
Cdd:cd17457 210 AIPFFFLP-------------------------------------------GFFQSL-------KSILTNRLYVMFVCLT 239
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17457 240 LLQVSSFIGFFTYKPKYMEQQYGQSSSKANFLLGVITLPIFASGMFLGGYIMKKYKLNTVGAAKFACFTSVMALSFYLLY 319
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRY-GNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTG-------CA 510
Cdd:cd17457 320 FFIGCENKSVAGITMTYdGNNPVTSHRDVILSYCNSDCNCDESQWDPVCGNNGITYISACLAGCKSSSGNGkpivfhnCS 399
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 84579880 511 CLTTVPPE--NASVVPGKCP-SPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17457 400 CLEVTGSQnrNYSAHLGECPrDDDCSRMFYFYVVIQVLNLFFSALGGTSAYMLIVK 455
MFS_SLCO2_OATP2 cd17401
Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of ...
39-563 8.17e-104

Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2 (SLCO2) or Organic anion transporting polypeptide 2 (OATP2) family contains two subfamilies: OATP2A and OATP2B, each containing one mammalian member, OATP2A1 and OATP2B1, respectively. OATP2A1 (encoded by SLCO2A1) is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. OATP2B1 (encoded by SLCO2B1) mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost, as well as endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). The SLCO2/OATP2 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340959 [Multi-domain]  Cd Length: 440  Bit Score: 324.11  E-value: 8.17e-104
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17401   1 IKVFVLCHGLLQLCQLLYSGYLKSSITTIEKRFGLSSSSSGLLASFNEVGNTILIVFVSYFGSRVHRPRLIGIGGLFLAA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKYEageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmylLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17401  81 GAFLLTLPHFISEPYQYG------------------------------------------IMVVAQLLLGIGGVPIQPFG 118
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17401 119 ISYIDDFAEPSNSPLYLGILFAVTVFGPAFGYLLGSVMLRLYVDIGRMNTAAVNLVPGDPRWIGAWWLGFLIAAALLVLT 198
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQSLpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlRVIPKVTKHLLSNPVFTCIVLAA 358
Cdd:cd17401 199 SFPYFFFPRFI----------------------------------------------KRFPCIFLRTLRNPIFLLVVLAQ 232
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17401 233 VTLSSMIAGLATFLNKFLEKQFGTTASYANFLIGAVNLPSAALGILFGGVLMKRLVLSLQAIPAICTTIITISMIFCVPL 312
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRygnnSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNL-----------T 507
Cdd:cd17401 313 FFIGCSTPTIAGVYPP----SSSSSIHPQSPACRRDCSCPDSIFNPVCGDNGVEYLSPCHAGCSNINMstsatskqviyT 388
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 84579880 508 GCACLTTvppENASVVPGKCPSPgCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17401 389 NCSCVTG---GSASAKTGSCPSP-CSHLLLPFIFLISLVSLIACLSHTPSFMMILR 440
MFS_SLCO1_OATP1 cd17400
Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of ...
39-563 2.97e-102

Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1 (SLCO1) or Organic anion transporting polypeptide 1 (OATP1) family contains three subfamilies: OATP1A, OATP1B, and OATP1C. OATP1A contains one human member, OATP1A2, which shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). OATP1B contains two human proteins, OATP1B1 and OATP1B3, which can both accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). OATP1C contains one mammalian member, OATP1C1, which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine). The SLCO1/OATP1 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340958 [Multi-domain]  Cd Length: 436  Bit Score: 319.86  E-value: 2.97e-102
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17400   1 LKMFLLALSCAFVAKTLSGSYMKSMITQIERRFNIPSSLVGFIDGSFEIGNLLVIIFVSYFGTKLHRPKMIGIGCVIMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHQYKYeageirwgaegrdvcatngsssdegpdpdlicrnrtatNMMYLLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17400  81 GCFLKALPHFFMNQYEY--------------------------------------SLMWIYVFVGNILRGIGETPILPLG 122
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17400 123 ISYIDDFAKEENSPLYIGLVETGAIIGPIIGFLLGSLCAKVYVDIGFVNLDDIIITPTDTRWVGAWWLGFLICGGVSVLT 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPqslpphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkhllsnPVFTCIVLAA 358
Cdd:cd17400 203 AIPFFFLP--------------------------------------------------------------PIYMLFILVS 220
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17400 221 VIQFNSFVGMITYMPKYLEQQYGQSSSDANFLMGIINIPPIAIGYFIGGLIMKKFKITVKGAAKIGCWLSVLEYLLYLLS 300
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRY-GNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTG-------CA 510
Cdd:cd17400 301 FLMTCENSSVAGLTTSYeGIPPVLYHENDIFSDCNSDCNCPEKIWEPVCGNNGITYLSACLAGCETSIGTGknivfynCS 380
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 84579880 511 CLTTVPPENA--SVVPGKCP-SPGCQEAFLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17400 381 CIQTSGNSSAnlSLCDGGCPrDPDCSLMFQYFLIISVMSSFIYSLGGIPGYMLLLR 436
MFS_SLCO4C_OATP4C cd17463
Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of ...
40-563 6.21e-89

Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4C (SLCO4C), also called Organic anion-transporting polypeptide 4C (OATP4C), subfamily has one mammalian member, OATP4C1 (encoded by SLCO4C1). It is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. It is the only OATP expressed at the basolateral side of proximal tubular cells in human kidney and it mediates the excretion of uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs) and cause further progression of renal damage and cardiovascular diseases. Overexpression of human SLCO4C1 in rat kidney promotes the renal excretion of uremic toxins and reduces hypertension, cardiomegaly, and renal inflammation in renal failure. The SLCO4C/OATP4C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341021 [Multi-domain]  Cd Length: 429  Bit Score: 285.10  E-value: 6.21e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  40 KIFLVSECALMLAQGTVGAYLVSV-LTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17463   2 KGYLLFYSLLAVVQGIVVNGLVNIsISTIEKRYELSSSLTGLISSSYDISFCLLSLFVSFYGERGHKPRWLAFSAFMIGL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmylLLIGAQVLLGIGATPVQPLG 198
Cdd:cd17463  82 GSLVFSLPHFF-------------------------------------------------VFILGQLLLGVGGTPLYTLG 112
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIdtSNLDITPDDPRWIGAWWGGFLLCGALLFFS 278
Cdd:cd17463 113 TAYIDDSVPTHKSSLYIGIGYGMSVLGPAIGYLLGGQLLNIYIDVNKG--QSVDLTEEDPRWLGAWWIGFLMCWLIAWCL 190
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 279 SLLMFGFPQSLPphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkHLLSNPVFTCIVLAA 358
Cdd:cd17463 191 IAPFSCFPKHLP-----------------------------------------------------GLLKNPVFMCLTISS 217
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 359 CMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSF 438
Cdd:cd17463 218 CSEALITTGFATFLPKFIENQFGQTSSFAAILGGLVLIPGAAIGQILGGIIVSKFKLKCKNMIKFAIITTTVSLLLLSVF 297
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 439 LFLGCDTGPVAGVTVRYgNNSARGSALDpySPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTG-------CAC 511
Cdd:cd17463 298 IFAKCGNDPFAGVSETY-NGTGKIGNLT--APCNANCSCLSSFYYPVCGADGVQYFSPCFAGCTNENLHDkkkvyynCSC 374
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 84579880 512 LTTVPPENASVVpGKCPSPGCQEA----FLTFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17463 375 IGNFTEEFSANT-TKCEEGKKCETtcknLPIFLCFFFFVVIFTFMTSTPITVAILR 429
MFS_SLCO4A_OATP4A cd17462
Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of ...
47-552 2.60e-84

Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4A (SLCO4A), also called Organic anion-transporting polypeptide 4A (OATP4A), subfamily has one mammalian member, OATP4A1 (encoded by SLCO4A1). It is ubiquitously expressed and it mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4A1 is the most abundantly expressed transporter colorectal cancer (CRC) and its role in the transport of estrone sulfate, which is used in hormone replacement therapy (HRT), affects the outcome of the treatment. The SLCO4A/OATP4A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341020 [Multi-domain]  Cd Length: 427  Bit Score: 272.86  E-value: 2.60e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  47 CALMLAQG-TVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSAL 125
Cdd:cd17462   9 CAASFLQGmTVNGFINTVITSIERRFDLRSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLIMGLGSLVFAL 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 126 PEFlthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtaTNMMYllligAQVLLGIGATPVQPLGVSYIDDH 205
Cdd:cd17462  89 PHF--------------------------------------------TVFML-----GQFLHGIGATPLYTLGVTYLDEN 119
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 206 VRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAvfidTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGF 285
Cdd:cd17462 120 VKSNYSPVYIGIFYTAAIVGPAAGYLLGGFFLNIYTEI----GRQTELTPENPLWVGAWWIGFLGAGAAALLIALPILGY 195
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 286 PQSLPphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkHLLSNPVFTCIVLAACMEIAVV 365
Cdd:cd17462 196 PRQLP-----------------------------------------------------GLLKNPTFIFLCLAGATEATLI 222
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 366 AGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFlFLGCDT 445
Cdd:cd17462 223 AGMSTFGPKFLESQFSLSASEAATLFGYLVVPAGGGGTFLGGFIVNKLKLRCSGIIKFCLICTVVSLLAIFIF-SLHCPN 301
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 446 GPVAGVTVRYGNNSARGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLT---------GCACLttvp 516
Cdd:cd17462 302 VPMAGVTASYRGSVLPEGSLNLTALCNADCRCLEEIYSPVCGADGLMYYSPCHAGCSEAYSDirngqkvyqDCSCV---- 377
                       490       500       510       520
                ....*....|....*....|....*....|....*....|...
gi 84579880 517 PENASV-----VPGKCPSPgCQE--AFLTFLCVMCVCSLIGAM 552
Cdd:cd17462 378 AGNLSVgfgeaSAGKCTSN-CNHmpLLLAFVFLVILFTFLCSI 419
MFS_SLCO6_OATP6 cd17405
Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of ...
39-563 9.27e-44

Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 6 (SLCO6) or Organic anion transporting polypeptide 6 (OATP6) family contains only one subfamily, OATP6A, which contains only one human member OATP6A1 (encoded by SLCO6A1). The OATP6 family is the most diverged of the OATPs. OATP6A1 is also called cancer/testis antigen 48 (CT48) or gonad-specific transporter. It is strongly expressed only in normal testis, and weakly in spleen, brain, fetal brain, and placenta. It is found in tumor samples (lung, bladder, and esophageal) and cancer cell lines (lung), and may be of potential use as a target for therapy for a variety of tumor types. The SLCO6/OATP6 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340963 [Multi-domain]  Cd Length: 428  Bit Score: 163.09  E-value: 9.27e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  39 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 118
Cdd:cd17405   1 IDGFMILYCILVLIQGAVFGLVDMSIGIFQVQFSLTRTEKYLLDFSYDISSFLVAIIIAHYGSRGNRTRWIAASCFLMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 119 GALLSALPEFLTHqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmmylllIGAQVLLGIGATPVQPLG 198
Cdd:cd17405  81 GSMLFAFPFFTFH-------------------------------------------------IAGQCIQGIAGMPIYILG 111
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 199 VSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKiyvdaVFIDTSNLDITPDD--PRWIGAWWGGFLLCGALLF 276
Cdd:cd17405 112 ITFIFDNIPTSSAGIYLGIAHSAYLIGYLLGYVGGLPNFQ-----PPPNEKSVEIEVNKvyQLWQSGWWKTFLIAAAIAW 186
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 277 FSSLLMFGFPQSLPphsdpgmeseqamlpereyerpkpsngvlrhplepdssascfqqlrvipkvtkHLLSNPVFTCIVL 356
Cdd:cd17405 187 CTSFPLVCFPTSLP-----------------------------------------------------GLLKNPLLLCQAI 213
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 357 AACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYV 436
Cdd:cd17405 214 CKATEYLTFIGALEFLPHYLENQFLLTPGIASLLTGAFLIPGGAIGHFLGGLIVSRLEMSCKNKMRFILVTSVISLGLFV 293
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 437 SFLFLGCDTGPVAGVTVRYGNNSARGSALdpySPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTN-------LTGC 509
Cdd:cd17405 294 LIFFVECQTVTFAGINEDYDGYGQLGNLT---APCNEYCDCTSSLYTSICGRDEIEYFSPCFAGCKASKvsntektYYNC 370
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 510 AC----LTTVPPENASV--VPGKCPSPgCQEAFLtFLCVMCVCSLIGAMAQTPSVIILIR 563
Cdd:cd17405 371 SCikegLAAADDEGDFIdaIAGKCDSK-CYKLPL-FFAFYFSATVFSNMCSIPIILIILR 428
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
467-511 3.28e-17

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650 [Multi-domain]  Cd Length: 54  Bit Score: 75.80  E-value: 3.28e-17
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|..
gi 84579880 467 PYSPCNNNCECQTDSFTPVCGADGITYLSACFAGC-------NSTNLTGCAC 511
Cdd:cd01330   1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCtnstgsgGSKIYTNCSC 52
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
47-456 9.77e-15

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 76.31  E-value: 9.77e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880  47 CALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALP 126
Cdd:cd06174   2 LLGFFLTGLARGLISPLLPALLQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAFA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 127 EflthqykyeageirwgaegrdvcatngsssdegpdpdlicrnrtatnmMYLLLIGAQVLLGIGATPVQPLGVSYIDDHV 206
Cdd:cd06174  82 P------------------------------------------------SFWLLLLGRFLLGLGSGLIDPAVLALIADLF 113
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 207 RRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVdavfidtsnlditpddprwiGAWWGGFLLCGALLFFSSLLMFGFP 286
Cdd:cd06174 114 PERERGRALGLLQAFGSVGGILGPLLGGILASSLG--------------------FGWRAVFLIAAALALLAAILLLLVV 173
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 287 QSLPPHSdpgmeseqamlpereyerpkpsngvlRHPLEPDSSASCFQQLRVipkvtkhLLSNPVFTCIVLAACMEIAVVA 366
Cdd:cd06174 174 PDPPESA--------------------------RAKNEEASSKSVLKLLKR-------VLKNPGLWLLLLAIFLVNLAYY 220
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 367 GFAAFLGKYLEQQFNLTTSSANQLLGMTAIpCACLGIFLGGLLVKKLSlsalgAIRMAMLVNLVSTACYVSFLFLGCDTG 446
Cdd:cd06174 221 SFSTLLPLFLLDLGGLSVAVAGLLLSLFGL-AGALGSLLLGLLSDRLI-----GRKPLLLIGLLLMALGLALLLLAPSLL 294
                       410
                ....*....|
gi 84579880 447 PVAGVTVRYG 456
Cdd:cd06174 295 LLLLLLLLLG 304
MFS_1 pfam07690
Major Facilitator Superfamily;
47-465 1.32e-11

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 66.68  E-value: 1.32e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880    47 CALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALp 126
Cdd:pfam07690   3 LAAFLAALGRSLLGPALPLLLAEDLGISPTEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLF- 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   127 eflthqykyeageirwgaegrdvcatngSSSdegpdpdlicrnrtatnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHV 206
Cdd:pfam07690  82 ----------------------------ASS-------------------LWLLLVLRVLQGLGAGALFPAAAALIADWF 114
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   207 RRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYvdavfidtsnlditpdDPRWIgawwggFLLCGALLFFSSLLMFGFp 286
Cdd:pfam07690 115 PPEERGRALGLLSAGFGLGAALGPLLGGLLASLF----------------GWRAA------FLILAILSLLAAVLAALL- 171
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   287 qslpphsdpgmeseqamLPEREYERPKPSNGVLRHplepdssascfqqlRVIPKVTKHLLSNPVFTCIVLAACMeIAVVA 366
Cdd:pfam07690 172 -----------------LPRPPPESKRPKPAEEAP--------------APLLPAWKLLLRDPVLWLLLALLLF-GFAFF 219
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880   367 GFAAFLGKYLEqQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKK---------LSLSALGAIRMAMLVNLVSTACYVS 437
Cdd:pfam07690 220 GLLTYLPLYQE-VLGLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLgrrrrlllaLLLLILAALGLLLLSLTLSSLWLLL 298
                         410       420       430
                  ....*....|....*....|....*....|...
gi 84579880   438 FLFL-----GCDTGPVAGVTVRYGNNSARGSAL 465
Cdd:pfam07690 299 ALLLlgfgfGLVFPALNALVSDLAPKEERGTAS 331
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
177-440 1.83e-07

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 53.73  E-value: 1.83e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 177 YLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYvdavfidtsnlditpd 256
Cdd:cd17325  84 YWQLLLARFLQGLASAAVWPAAMALIADIAPPEERGRAMGIFSSAIGLGFLIGPLLGGLLADAL---------------- 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 257 dprwigAWWGGFLLCGALLFFSSLLMFGFPqslpphsdpgmeseqamlpeREYERPKPSNGVlrhplepdssascfQQLR 336
Cdd:cd17325 148 ------GYRAPFLVCAALALLALVLALLLL--------------------PEPRPPPNKRAV--------------SAAR 187
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84579880 337 VIPKVTKHLLSNPVFTCIVLAACMEIAvVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKklsls 416
Cdd:cd17325 188 LRSGLRLLLRDRRLLALFLAIFVLAFA-FGALEPFLPLYAAELGGLSPAQIGLLFGAQGLASALSQPPAGKLSDR----- 261
                       250       260
                ....*....|....*....|....
gi 84579880 417 aLGAIRMAMLVNLVSTACYVSFLF 440
Cdd:cd17325 262 -IGRKPLILIGLLLSAVALLLLPL 284
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
474-511 1.10e-05

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 400135  Cd Length: 50  Bit Score: 42.87  E-value: 1.10e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 84579880   474 NCECQTDSFTPVCGADGITYLSAC---FAGCNSTNLTG-------CAC 511
Cdd:pfam07648   3 NCQCPKTEYEPVCGSDGVTYPSPCalcAAGCKLGKEVKeekvkydGSC 50
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
479-511 5.83e-05

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 40.72  E-value: 5.83e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 84579880 479 TDSFTPVCGADGITYLSACFAGC-------NSTNLTGCAC 511
Cdd:cd00104   2 PKEYDPVCGSDGKTYSNECHLGCaacrsgrSITVAHNGPC 41
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
471-503 2.04e-03

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


Pssm-ID: 197624  Cd Length: 46  Bit Score: 36.50  E-value: 2.04e-03
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 84579880    471 CNNNCecqTDSFTPVCGADGITYLSACF---AGCNS 503
Cdd:smart00280   2 CPEAC---PREYDPVCGSDGVTYSNECHlckAACES 34
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH