NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13129128|ref|NP_077017|]
View 

bublin coiled-coil protein [Homo sapiens]

Protein Classification

UPF0184 family protein (domain architecture ID 10508482)

UPF0184 family protein similar to Homo sapiens protein C9orf16

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
UPF0184 pfam03670
Uncharacterized protein family (UPF0184);
1-83 1.34e-37

Uncharacterized protein family (UPF0184);


:

Pssm-ID: 112485  Cd Length: 83  Bit Score: 120.44  E-value: 1.34e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13129128    1 MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSD 80
Cdd:pfam03670  1 MSGPNGDDPSSVEDGGNTNVDEFGLQEYEAINSMLDQINSALDALEERNDDLMSQLRELLESNRQIRLEFAEQLDNAPES 80

                 ...
gi 13129128   81 ASP 83
Cdd:pfam03670 81 GSD 83
 
Name Accession Description Interval E-value
UPF0184 pfam03670
Uncharacterized protein family (UPF0184);
1-83 1.34e-37

Uncharacterized protein family (UPF0184);


Pssm-ID: 112485  Cd Length: 83  Bit Score: 120.44  E-value: 1.34e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13129128    1 MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSD 80
Cdd:pfam03670  1 MSGPNGDDPSSVEDGGNTNVDEFGLQEYEAINSMLDQINSALDALEERNDDLMSQLRELLESNRQIRLEFAEQLDNAPES 80

                 ...
gi 13129128   81 ASP 83
Cdd:pfam03670 81 GSD 83
 
Name Accession Description Interval E-value
UPF0184 pfam03670
Uncharacterized protein family (UPF0184);
1-83 1.34e-37

Uncharacterized protein family (UPF0184);


Pssm-ID: 112485  Cd Length: 83  Bit Score: 120.44  E-value: 1.34e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13129128    1 MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSD 80
Cdd:pfam03670  1 MSGPNGDDPSSVEDGGNTNVDEFGLQEYEAINSMLDQINSALDALEERNDDLMSQLRELLESNRQIRLEFAEQLDNAPES 80

                 ...
gi 13129128   81 ASP 83
Cdd:pfam03670 81 GSD 83
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH