NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13384636|ref|NP_079564|]
View 

stefin-3 [Mus musculus]

Protein Classification

CY domain-containing protein (domain architecture ID 10440427)

CY domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cystatin pfam00031
Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. ...
10-96 1.39e-26

Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. Typically, either the N-terminal or C-terminal end is very divergent. But splitting into two domains would make very short families. pfam00666 is related to this family but members have not been included.


:

Pssm-ID: 394988  Cd Length: 92  Bit Score: 93.56  E-value: 1.39e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13384636    10 GGLSEARPATPEIQMIADKVRPLLEEQT-NEKYEKFEAVEYKSQVVAGQNLFIKIDVGNGCFL-HMKVFRGLSGED--DL 85
Cdd:pfam00031   1 GGLSPIPDNSPELQEALDFALAEYNAKTdNYYFELVEVKRAKSQVVAGTNYFIKVEVGETDCSkSKKLLEDCPLLDekWL 80
                          90
                  ....*....|.
gi 13384636    86 KLKGYQTNKTK 96
Cdd:pfam00031  81 GLCSAQVYKVP 91
 
Name Accession Description Interval E-value
Cystatin pfam00031
Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. ...
10-96 1.39e-26

Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. Typically, either the N-terminal or C-terminal end is very divergent. But splitting into two domains would make very short families. pfam00666 is related to this family but members have not been included.


Pssm-ID: 394988  Cd Length: 92  Bit Score: 93.56  E-value: 1.39e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13384636    10 GGLSEARPATPEIQMIADKVRPLLEEQT-NEKYEKFEAVEYKSQVVAGQNLFIKIDVGNGCFL-HMKVFRGLSGED--DL 85
Cdd:pfam00031   1 GGLSPIPDNSPELQEALDFALAEYNAKTdNYYFELVEVKRAKSQVVAGTNYFIKVEVGETDCSkSKKLLEDCPLLDekWL 80
                          90
                  ....*....|.
gi 13384636    86 KLKGYQTNKTK 96
Cdd:pfam00031  81 GLCSAQVYKVP 91
CY smart00043
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
10-68 1.88e-14

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 214484  Cd Length: 107  Bit Score: 63.22  E-value: 1.88e-14
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13384636     10 GGLSEARPATPEIQMIADKVRPLLEEQTNEKYE--KFEAVEYKSQVVAGQNLFIKIDVGNG 68
Cdd:smart00043   4 GGPSDVPPNDPEVQEAADFAVAEYNKKSNDKYElrVIKVVSAKSQVVAGTNYYLKVEVGET 64
CY cd00042
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
10-68 3.64e-11

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 238002  Cd Length: 105  Bit Score: 54.79  E-value: 3.64e-11
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 13384636  10 GGLSEARPATPEIQMIADKVRPLLEEQTNEKY-EKFEAVEYKSQVVAGQNLFIKIDVGNG 68
Cdd:cd00042   1 GGPSDIPANDPEVQELADFAVAEYNKKSNDKYlEFFKVLSAKSQVVAGTNYYITVEAGDT 60
 
Name Accession Description Interval E-value
Cystatin pfam00031
Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. ...
10-96 1.39e-26

Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. Typically, either the N-terminal or C-terminal end is very divergent. But splitting into two domains would make very short families. pfam00666 is related to this family but members have not been included.


Pssm-ID: 394988  Cd Length: 92  Bit Score: 93.56  E-value: 1.39e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13384636    10 GGLSEARPATPEIQMIADKVRPLLEEQT-NEKYEKFEAVEYKSQVVAGQNLFIKIDVGNGCFL-HMKVFRGLSGED--DL 85
Cdd:pfam00031   1 GGLSPIPDNSPELQEALDFALAEYNAKTdNYYFELVEVKRAKSQVVAGTNYFIKVEVGETDCSkSKKLLEDCPLLDekWL 80
                          90
                  ....*....|.
gi 13384636    86 KLKGYQTNKTK 96
Cdd:pfam00031  81 GLCSAQVYKVP 91
CY smart00043
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
10-68 1.88e-14

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 214484  Cd Length: 107  Bit Score: 63.22  E-value: 1.88e-14
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13384636     10 GGLSEARPATPEIQMIADKVRPLLEEQTNEKYE--KFEAVEYKSQVVAGQNLFIKIDVGNG 68
Cdd:smart00043   4 GGPSDVPPNDPEVQEAADFAVAEYNKKSNDKYElrVIKVVSAKSQVVAGTNYYLKVEVGET 64
CY cd00042
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
10-68 3.64e-11

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 238002  Cd Length: 105  Bit Score: 54.79  E-value: 3.64e-11
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 13384636  10 GGLSEARPATPEIQMIADKVRPLLEEQTNEKY-EKFEAVEYKSQVVAGQNLFIKIDVGNG 68
Cdd:cd00042   1 GGPSDIPANDPEVQELADFAVAEYNKKSNDKYlEFFKVLSAKSQVVAGTNYYITVEAGDT 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH