NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|118150645|ref|NP_080918|]
View 

tRNA wybutosine-synthesizing protein 2 homolog [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Trm5 super family cl34477
tRNA G37 N-methylase Trm5 [Translation, ribosomal structure and biogenesis];
99-432 7.15e-56

tRNA G37 N-methylase Trm5 [Translation, ribosomal structure and biogenesis];


The actual alignment was detected with superfamily member COG2520:

Pssm-ID: 225318 [Multi-domain]  Cd Length: 341  Bit Score: 188.30  E-value: 7.15e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  99 LEVRRWVEDRGvtWSAELEADLPRSWQRHGDLMLLSEDcfqatlwKGLEPELWETVASALGVQR-----LAKRGRVlpDG 173
Cdd:COG2520   67 ENLKEILSDRL--PEEVLRELVPSSFDIIGDIAILSIP-------DELEPYKREIAEAILRVHGkvkavLLKEGPV--AG 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 174 T-RTPSVTLLLGD-HGWVEHMDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPfLVHAGAAFV 251
Cdd:COG2520  136 EfRVPRLEVLAGErRTETIHRENGCRFKVDVAKVYFSPRLSTERARVAELVKEGETVLDMFAGVGPFSIP-IAKKGRPKV 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 252 HACEWNPHAVVALRNNLEINGVADRCQIHFGDNRK-LKLSDIADRVNLGLIPSSKEGWPVACQVLRKdvGGILHIHQNVE 330
Cdd:COG2520  215 YAIDINPDAVEYLKENIRLNKVEGRVEPILGDAREvAPELGVADRIIMGLPKSAHEFLPLALELLKD--GGIIHYYEFVP 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 331 sfsgktpqppgsnnvEKEHWPRPQKittdtqgngttenfrgEISSANKPewwrwaesaetqiasllhqvHGKpwRTRILH 410
Cdd:COG2520  293 ---------------EDDIEERPEK----------------RIKSAARK--------------------GGY--KVEVLK 319
                        330       340
                 ....*....|....*....|..
gi 118150645 411 VHPVKSYAPHVDHIVLDLECRP 432
Cdd:COG2520  320 VRRVKSYSPGVYHVVVDLRVLK 341
 
Name Accession Description Interval E-value
Trm5 COG2520
tRNA G37 N-methylase Trm5 [Translation, ribosomal structure and biogenesis];
99-432 7.15e-56

tRNA G37 N-methylase Trm5 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 225318 [Multi-domain]  Cd Length: 341  Bit Score: 188.30  E-value: 7.15e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  99 LEVRRWVEDRGvtWSAELEADLPRSWQRHGDLMLLSEDcfqatlwKGLEPELWETVASALGVQR-----LAKRGRVlpDG 173
Cdd:COG2520   67 ENLKEILSDRL--PEEVLRELVPSSFDIIGDIAILSIP-------DELEPYKREIAEAILRVHGkvkavLLKEGPV--AG 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 174 T-RTPSVTLLLGD-HGWVEHMDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPfLVHAGAAFV 251
Cdd:COG2520  136 EfRVPRLEVLAGErRTETIHRENGCRFKVDVAKVYFSPRLSTERARVAELVKEGETVLDMFAGVGPFSIP-IAKKGRPKV 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 252 HACEWNPHAVVALRNNLEINGVADRCQIHFGDNRK-LKLSDIADRVNLGLIPSSKEGWPVACQVLRKdvGGILHIHQNVE 330
Cdd:COG2520  215 YAIDINPDAVEYLKENIRLNKVEGRVEPILGDAREvAPELGVADRIIMGLPKSAHEFLPLALELLKD--GGIIHYYEFVP 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 331 sfsgktpqppgsnnvEKEHWPRPQKittdtqgngttenfrgEISSANKPewwrwaesaetqiasllhqvHGKpwRTRILH 410
Cdd:COG2520  293 ---------------EDDIEERPEK----------------RIKSAARK--------------------GGY--KVEVLK 319
                        330       340
                 ....*....|....*....|..
gi 118150645 411 VHPVKSYAPHVDHIVLDLECRP 432
Cdd:COG2520  320 VRRVKSYSPGVYHVVVDLRVLK 341
Met_10 pfam02475
Met-10+ like-protein; The methionine-10 mutant allele of N. crassa codes for a protein of ...
122-324 4.88e-34

Met-10+ like-protein; The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast, suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation.


Pssm-ID: 396850 [Multi-domain]  Cd Length: 198  Bit Score: 126.31  E-value: 4.88e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  122 RSWQRHGDLMLLSedcfqatlwkgLEPEL-------WETVASALGVQR-LAKRGRVlpDG-TRTPSVTLLLGDHGWVEHM 192
Cdd:pfam02475   1 TSFDIIGDVVILN-----------LREELdeyrkviGEAILEKTKVKTvLRKVSEV--YGeFRTPRYEVLAGSDTETIHK 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  193 DNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEING 272
Cdd:pfam02475  68 ENGCRFKVDVAKVYWSPRLIAERERIAKLVEPGEVVVDMFAGIGPFSIPIAKHSKARRVYAIELNPESYKYLKENIKLNK 147
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 118150645  273 VADRCQIHFGDNRKLKLSDIADRVNLGLIPSSKEGWPVACQVLRKdvGGILH 324
Cdd:pfam02475 148 VEDVVKPILGDVREVILEDVADRVVMNLPGSAHEFLDKAFAAVRD--GGVIH 197
 
Name Accession Description Interval E-value
Trm5 COG2520
tRNA G37 N-methylase Trm5 [Translation, ribosomal structure and biogenesis];
99-432 7.15e-56

tRNA G37 N-methylase Trm5 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 225318 [Multi-domain]  Cd Length: 341  Bit Score: 188.30  E-value: 7.15e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  99 LEVRRWVEDRGvtWSAELEADLPRSWQRHGDLMLLSEDcfqatlwKGLEPELWETVASALGVQR-----LAKRGRVlpDG 173
Cdd:COG2520   67 ENLKEILSDRL--PEEVLRELVPSSFDIIGDIAILSIP-------DELEPYKREIAEAILRVHGkvkavLLKEGPV--AG 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 174 T-RTPSVTLLLGD-HGWVEHMDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPfLVHAGAAFV 251
Cdd:COG2520  136 EfRVPRLEVLAGErRTETIHRENGCRFKVDVAKVYFSPRLSTERARVAELVKEGETVLDMFAGVGPFSIP-IAKKGRPKV 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 252 HACEWNPHAVVALRNNLEINGVADRCQIHFGDNRK-LKLSDIADRVNLGLIPSSKEGWPVACQVLRKdvGGILHIHQNVE 330
Cdd:COG2520  215 YAIDINPDAVEYLKENIRLNKVEGRVEPILGDAREvAPELGVADRIIMGLPKSAHEFLPLALELLKD--GGIIHYYEFVP 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 331 sfsgktpqppgsnnvEKEHWPRPQKittdtqgngttenfrgEISSANKPewwrwaesaetqiasllhqvHGKpwRTRILH 410
Cdd:COG2520  293 ---------------EDDIEERPEK----------------RIKSAARK--------------------GGY--KVEVLK 319
                        330       340
                 ....*....|....*....|..
gi 118150645 411 VHPVKSYAPHVDHIVLDLECRP 432
Cdd:COG2520  320 VRRVKSYSPGVYHVVVDLRVLK 341
Met_10 pfam02475
Met-10+ like-protein; The methionine-10 mutant allele of N. crassa codes for a protein of ...
122-324 4.88e-34

Met-10+ like-protein; The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast, suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation.


Pssm-ID: 396850 [Multi-domain]  Cd Length: 198  Bit Score: 126.31  E-value: 4.88e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  122 RSWQRHGDLMLLSedcfqatlwkgLEPEL-------WETVASALGVQR-LAKRGRVlpDG-TRTPSVTLLLGDHGWVEHM 192
Cdd:pfam02475   1 TSFDIIGDVVILN-----------LREELdeyrkviGEAILEKTKVKTvLRKVSEV--YGeFRTPRYEVLAGSDTETIHK 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645  193 DNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEING 272
Cdd:pfam02475  68 ENGCRFKVDVAKVYWSPRLIAERERIAKLVEPGEVVVDMFAGIGPFSIPIAKHSKARRVYAIELNPESYKYLKENIKLNK 147
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 118150645  273 VADRCQIHFGDNRKLKLSDIADRVNLGLIPSSKEGWPVACQVLRKdvGGILH 324
Cdd:pfam02475 148 VEDVVKPILGDVREVILEDVADRVVMNLPGSAHEFLDKAFAAVRD--GGVIH 197
TrmA COG2265
tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family [Translation, ribosomal structure ...
212-290 7.45e-06

tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family [Translation, ribosomal structure and biogenesis];


Pssm-ID: 225174 [Multi-domain]  Cd Length: 432  Bit Score: 48.08  E-value: 7.45e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 212 ITEKLRVASLSCA----GEVLVDLYAGIGYFTLPFlvhA-GAAFVHACEWNPHAVVALRNNLEINGVaDRCQIHFGDNRK 286
Cdd:COG2265  277 VAEKLYETALEWLelagGERVLDLYCGVGTFGLPL---AkRVKKVHGVEISPEAVEAAQENAAANGI-DNVEFIAGDAEE 352

                 ....
gi 118150645 287 LKLS 290
Cdd:COG2265  353 FTPA 356
Dcm COG0270
Site-specific DNA-cytosine methylase [Replication, recombination and repair];
228-313 1.68e-03

Site-specific DNA-cytosine methylase [Replication, recombination and repair];


Pssm-ID: 223348 [Multi-domain]  Cd Length: 328  Bit Score: 40.11  E-value: 1.68e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118150645 228 LVDLYAGIGYFTLPFLvHAGAAFVHACEWNPHAVVALRNNLEIngvadrCQIHFGDNRKLKLSDIADRVNLGLIPSSKeg 307
Cdd:COG0270    6 VIDLFAGIGGLSLGFE-EAGFEIVFANEIDPPAVATYKANFPH------GDIILGDIKELDGEALRKSDVDVLIGGPP-- 76

                 ....*.
gi 118150645 308 wpvaCQ 313
Cdd:COG0270   77 ----CQ 78
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH