NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|198278539|ref|NP_081311|]
View 

uncharacterized protein C5orf49 homolog [Mus musculus]

Protein Classification

DUF4541 domain-containing protein (domain architecture ID 10633396)

DUF4541 domain-containing protein similar to Homo sapiens protein C5orf49

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF4541 pfam15074
Domain of unknown function (DUF4541); This family of proteins is found in eukaryotes. Proteins ...
77-168 4.98e-49

Domain of unknown function (DUF4541); This family of proteins is found in eukaryotes. Proteins in this family are typically between 100 and 163 amino acids in length. There is a conserved KLHRDDR sequence motif. There is a single completely conserved residue Y that may be functionally important. In humans, the gene is found in the chromosomal location, C5orf49.


:

Pssm-ID: 405720  Cd Length: 92  Bit Score: 153.56  E-value: 4.98e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 198278539   77 SYFSREGQTGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVS 156
Cdd:pfam15074   1 TYFNNEKKTGIVSTYDRLFKRPEGYNSKLHRDDREHAKSIGLNINKEEKAKPVPVLSSSVYGRRLRRPLDPPDRDHVRVA 80
                          90
                  ....*....|..
gi 198278539  157 HVKTDFYRKNEI 168
Cdd:pfam15074  81 HVRAEFYRKNGI 92
 
Name Accession Description Interval E-value
DUF4541 pfam15074
Domain of unknown function (DUF4541); This family of proteins is found in eukaryotes. Proteins ...
77-168 4.98e-49

Domain of unknown function (DUF4541); This family of proteins is found in eukaryotes. Proteins in this family are typically between 100 and 163 amino acids in length. There is a conserved KLHRDDR sequence motif. There is a single completely conserved residue Y that may be functionally important. In humans, the gene is found in the chromosomal location, C5orf49.


Pssm-ID: 405720  Cd Length: 92  Bit Score: 153.56  E-value: 4.98e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 198278539   77 SYFSREGQTGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVS 156
Cdd:pfam15074   1 TYFNNEKKTGIVSTYDRLFKRPEGYNSKLHRDDREHAKSIGLNINKEEKAKPVPVLSSSVYGRRLRRPLDPPDRDHVRVA 80
                          90
                  ....*....|..
gi 198278539  157 HVKTDFYRKNEI 168
Cdd:pfam15074  81 HVRAEFYRKNGI 92
 
Name Accession Description Interval E-value
DUF4541 pfam15074
Domain of unknown function (DUF4541); This family of proteins is found in eukaryotes. Proteins ...
77-168 4.98e-49

Domain of unknown function (DUF4541); This family of proteins is found in eukaryotes. Proteins in this family are typically between 100 and 163 amino acids in length. There is a conserved KLHRDDR sequence motif. There is a single completely conserved residue Y that may be functionally important. In humans, the gene is found in the chromosomal location, C5orf49.


Pssm-ID: 405720  Cd Length: 92  Bit Score: 153.56  E-value: 4.98e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 198278539   77 SYFSREGQTGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVS 156
Cdd:pfam15074   1 TYFNNEKKTGIVSTYDRLFKRPEGYNSKLHRDDREHAKSIGLNINKEEKAKPVPVLSSSVYGRRLRRPLDPPDRDHVRVA 80
                          90
                  ....*....|..
gi 198278539  157 HVKTDFYRKNEI 168
Cdd:pfam15074  81 HVRAEFYRKNGI 92
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH