NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|31542429|ref|NP_291094|]
View 

component of Sp100-rs [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 super family cl37946
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
106-273 6.25e-06

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


The actual alignment was detected with superfamily member pfam00001:

Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 46.53  E-value: 6.25e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429   106 LTLTLMALNTYLAICYPLNSPSFVDSAK-YRILAGTWTTVILKNVGLFLIEGTSPTP-ASVFQSAPLCPVILNGMPARVI 183
Cdd:pfam00001  74 LLLTAISIDRYLAIVHPLRYRRIRTPRRaKVLILLVWVLALLLSLPPLLFGWTLTVPeGNVTVCLIDFPEDLVKPVSYTL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429   184 GMFSLAFL--LSVILVSYCLIYRE------GKQAGHFNKSNIKARRTVLVHLLQISLHVIPTLI--IIGLGKRCGVFFFA 253
Cdd:pfam00001 154 LISVLGFLlpLLVILVCYTRIYRTlrksasKQKSEERTQRRRKALKTLAVVVVVFILCWLPYHIvlLLDSLALDCELSRL 233
                         170       180
                  ....*....|....*....|...
gi 31542429   254 LNLALFGIFAFA---QCFNPLVY 273
Cdd:pfam00001 234 LDKALSVTLWLAyvnSCLNPIIY 256
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
106-273 6.25e-06

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 46.53  E-value: 6.25e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429   106 LTLTLMALNTYLAICYPLNSPSFVDSAK-YRILAGTWTTVILKNVGLFLIEGTSPTP-ASVFQSAPLCPVILNGMPARVI 183
Cdd:pfam00001  74 LLLTAISIDRYLAIVHPLRYRRIRTPRRaKVLILLVWVLALLLSLPPLLFGWTLTVPeGNVTVCLIDFPEDLVKPVSYTL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429   184 GMFSLAFL--LSVILVSYCLIYRE------GKQAGHFNKSNIKARRTVLVHLLQISLHVIPTLI--IIGLGKRCGVFFFA 253
Cdd:pfam00001 154 LISVLGFLlpLLVILVCYTRIYRTlrksasKQKSEERTQRRRKALKTLAVVVVVFILCWLPYHIvlLLDSLALDCELSRL 233
                         170       180
                  ....*....|....*....|...
gi 31542429   254 LNLALFGIFAFA---QCFNPLVY 273
Cdd:pfam00001 234 LDKALSVTLWLAyvnSCLNPIIY 256
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
89-277 1.14e-05

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 45.74  E-value: 1.14e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429  89 LCWLVFGAQLSVGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIEGTSPTPASVFQs 167
Cdd:cd00637  70 LCKLLGFLQSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLiALIWLLSLLLALPPLLGWGVYDYGGYCCC- 148
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 168 aPLCPVILNGMPARVIGMFSLAFL--LSVILVSYCLIYRE-------------GKQAGHFNKSNIKARRTVLVHLLQISL 232
Cdd:cd00637 149 -CLCWPDLTLSKAYTIFLFVLLFLlpLLVIIVCYVRIFRKlrrhrrrirssssNSSRRRRRRRERKVTKTLLIVVVVFLL 227
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 31542429 233 HVIPTLIIIGLGKRCGVFFFALNLALFGIFAFAQ---CFNPLVYGLHN 277
Cdd:cd00637 228 CWLPYFILLLLDVFGPDPSPLPRILYFLALLLAYlnsAINPIIYAFFN 275
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
106-273 6.25e-06

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 46.53  E-value: 6.25e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429   106 LTLTLMALNTYLAICYPLNSPSFVDSAK-YRILAGTWTTVILKNVGLFLIEGTSPTP-ASVFQSAPLCPVILNGMPARVI 183
Cdd:pfam00001  74 LLLTAISIDRYLAIVHPLRYRRIRTPRRaKVLILLVWVLALLLSLPPLLFGWTLTVPeGNVTVCLIDFPEDLVKPVSYTL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429   184 GMFSLAFL--LSVILVSYCLIYRE------GKQAGHFNKSNIKARRTVLVHLLQISLHVIPTLI--IIGLGKRCGVFFFA 253
Cdd:pfam00001 154 LISVLGFLlpLLVILVCYTRIYRTlrksasKQKSEERTQRRRKALKTLAVVVVVFILCWLPYHIvlLLDSLALDCELSRL 233
                         170       180
                  ....*....|....*....|...
gi 31542429   254 LNLALFGIFAFA---QCFNPLVY 273
Cdd:pfam00001 234 LDKALSVTLWLAyvnSCLNPIIY 256
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
89-277 1.14e-05

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 45.74  E-value: 1.14e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429  89 LCWLVFGAQLSVGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIEGTSPTPASVFQs 167
Cdd:cd00637  70 LCKLLGFLQSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLiALIWLLSLLLALPPLLGWGVYDYGGYCCC- 148
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 168 aPLCPVILNGMPARVIGMFSLAFL--LSVILVSYCLIYRE-------------GKQAGHFNKSNIKARRTVLVHLLQISL 232
Cdd:cd00637 149 -CLCWPDLTLSKAYTIFLFVLLFLlpLLVIIVCYVRIFRKlrrhrrrirssssNSSRRRRRRRERKVTKTLLIVVVVFLL 227
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 31542429 233 HVIPTLIIIGLGKRCGVFFFALNLALFGIFAFAQ---CFNPLVYGLHN 277
Cdd:cd00637 228 CWLPYFILLLLDVFGPDPSPLPRILYFLALLLAYlnsAINPIIYAFFN 275
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
106-235 2.29e-04

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222 [Multi-domain]  Cd Length: 282  Bit Score: 42.08  E-value: 2.29e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 106 LTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIegTSPTPASVFQSaplCPVI------LNGM 178
Cdd:cd15094  88 FTLTVMSADRYLAVCHPIRSMRYRTPFIAKVVcATTWSISFLVMLPIILY--ASTVPDSGRYS---CTIVwpdssaVNGQ 162
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 31542429 179 PARVIGMFSLAFL--LSVILVSYCLIYREGKQAGHFNKSNIKARR----TVLVhLLQISLHVI 235
Cdd:cd15094 163 KAFTLYTFLLGFAipLLLISVFYTLVILRLRTVGPKNKSKEKRRShrkvTRLV-LTVISVYII 224
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
105-208 1.12e-03

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132 [Multi-domain]  Cd Length: 266  Bit Score: 39.57  E-value: 1.12e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 105 LLTLTLMALNTYLAICYPLNSPSF--VDSAKyRILAGTWTTVILKNVGLFLIEGTSPTPASVFQSAPLCPVILNGM---P 179
Cdd:cd15001  87 VLTLTAISIERYYVILHPMKAKSFctIGRAR-KVALLIWILSAILASPVLFGQGLVRYESENGVTVYHCQKAWPSTlysR 165
                        90       100
                ....*....|....*....|....*....
gi 31542429 180 ARVIGMFSLAFLLSVILVSYCLIYREGKQ 208
Cdd:cd15001 166 LYVVYLAIVIFFIPLIVMTFAYARDTRKQ 194
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
106-278 4.19e-03

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 37.96  E-value: 4.19e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 106 LTLTLMALNTYLAICYPLNSPS-FVDSAKYRILAGTWTTVILKNVGLFLIEGTSPTPASVF--QSAPLC-PVILNGMPAR 181
Cdd:cd14993  89 LTLVAISIDRYLAICYPLKARRvSTKRRARIIIVAIWVIAIIIMLPLLVVYELEEIISSEPgtITIYICtEDWPSPELRK 168
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 182 VIGMFSLAFL----LSVILVSYCLIYRE---GKQAGHFNKSN-------IKARR------TVLVHLLQIS---LHVIPTL 238
Cdd:cd14993 169 AYNVALFVVLyvlpLLIISVAYSLIGRRlwrRKPPGDRGSANstssrriLRSKKkvarmlIVVVVLFALSwlpYYVLSIL 248
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 31542429 239 IIIGlgkrcGVFFFALNLALFGIFAFAQCF-------NPLVYGLHNR 278
Cdd:cd14993 249 LDFG-----PLSSEESDENFLLILPFAQLLgysnsaiNPIIYCFMSK 290
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
106-279 8.86e-03

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 36.77  E-value: 8.86e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 106 LTLTLMALNTYLAICYPLNSPSFVDSAK-YRILAGTWTTVILknVGLFLIEGTSPTPaSVFQSAPLCPVILNgmPARVIG 184
Cdd:cd14967  88 LNLCAISLDRYLAITRPLRYRQLMTKKRaLIMIAAVWVYSLL--ISLPPLVGWRDET-QPSVVDCECEFTPN--KIYVLV 162
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542429 185 MFSLAFLL--SVILVSYCLIYREGKQaghfnksNIKARRTVLVHLLQISLHVIPTLIIIGLGKRCGVFFF-ALNLALFGI 261
Cdd:cd14967 163 SSVISFFIplLIMIVLYARIFRVARR-------ELKAAKTLAIIVGAFLLCWLPFFIIYLVSAFCPPDCVpPILYAVFFW 235
                       170
                ....*....|....*....
gi 31542429 262 FAFAQ-CFNPLVYGLHNRD 279
Cdd:cd14967 236 LGYLNsALNPIIYALFNRD 254
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH