NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16129061|ref|NP_415616|]
View 

hypothetical protein b1098 [Escherichia coli str. K-12 substr. MG1655]

Protein Classification

thymidylate kinase (domain architecture ID 11479105)

thymidylate kinase catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
tmk PRK00698
thymidylate kinase; Validated
1-209 1.18e-110

thymidylate kinase; Validated


:

Pssm-ID: 234814  Cd Length: 205  Bit Score: 314.82  E-value: 1.18e-110
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLDiksvGDEVITDKAEVLMFYAARVQ 80
Cdd:PRK00698   1 MRGMFITIEGIDGAGKSTQIELLKELLEQQG-RDVVFTREPGGTPLGEKLRELLLD----PNEEMDDKTELLLFYAARAQ 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIE 160
Cdd:PRK00698  76 HLEEVIKPALARGKWVISDRFIDSSLAYQGGGRGLDIDLLLALNDFALGGFRPDLTLYLDVPPEVGLARIRARGELDRIE 155
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 16129061  161 QESFDFFNRTRARYLELAAQ-DKSIHTIDATQPLEAVMDAIRTTVTHWVK 209
Cdd:PRK00698 156 QEGLDFFERVREGYLELAEKePERIVVIDASQSLEEVHEDILAVIKAWLE 205
 
Name Accession Description Interval E-value
tmk PRK00698
thymidylate kinase; Validated
1-209 1.18e-110

thymidylate kinase; Validated


Pssm-ID: 234814  Cd Length: 205  Bit Score: 314.82  E-value: 1.18e-110
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLDiksvGDEVITDKAEVLMFYAARVQ 80
Cdd:PRK00698   1 MRGMFITIEGIDGAGKSTQIELLKELLEQQG-RDVVFTREPGGTPLGEKLRELLLD----PNEEMDDKTELLLFYAARAQ 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIE 160
Cdd:PRK00698  76 HLEEVIKPALARGKWVISDRFIDSSLAYQGGGRGLDIDLLLALNDFALGGFRPDLTLYLDVPPEVGLARIRARGELDRIE 155
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 16129061  161 QESFDFFNRTRARYLELAAQ-DKSIHTIDATQPLEAVMDAIRTTVTHWVK 209
Cdd:PRK00698 156 QEGLDFFERVREGYLELAEKePERIVVIDASQSLEEVHEDILAVIKAWLE 205
DTMP_kinase TIGR00041
dTMP kinase; Function: phosphorylation of DTMP to form DTDP in both de novo and salvage ...
1-200 6.09e-91

dTMP kinase; Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]


Pssm-ID: 161676  Cd Length: 195  Bit Score: 264.61  E-value: 6.09e-91
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061     1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLdikSVGDEVITDKAEVLMFYAARVQ 80
Cdd:TIGR00041   1 MRGMFIVIEGIDGAGKTTQANLLKKLLQENG-YDVLFTREPGGTPIGEKIRELLL---NENDEPLTDKAEALLFAADRHE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDfRPDLTLYLDVTPEVGLKRARARGELDRIE 160
Cdd:TIGR00041  77 HLEDKIKPALAEGKLVISDRYVFSSIAYQGGARGIDEDLVLELNEDALGD-MPDLTIYLDIDPEVALERLRKRGELDREE 155
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 16129061   161 QESFDFFNRTRARYLELAAQDKSIHTIDATQPLEAVMDAI 200
Cdd:TIGR00041 156 FEKLDFFEKVRQRYLELADKEKSIHVIDATNSVEEVEQDI 195
Tmk COG0125
Thymidylate kinase [Nucleotide transport and metabolism];
1-210 1.36e-83

Thymidylate kinase [Nucleotide transport and metabolism];


Pssm-ID: 223203  Cd Length: 208  Bit Score: 246.82  E-value: 1.36e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIrDMVFTREPGGTQLAEKLRSLVLDiksvGDEVITDKAEVLMFYAARVQ 80
Cdd:COG0125   1 MKGMFIVIEGIDGAGKTTQAELLKERLEERGI-KVVLTREPGGTPIGEKIRELLLN----GEEKLSPKAEALLFAADRAQ 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061  81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGEL-DRI 159
Cdd:COG0125  76 HLEEVIKPALKEGKVVICDRYVDSSLAYQGGGRGLDLDWVLALNEFAPGGLKPDLTLYLDVPPEVALERIRKRGELrDRF 155
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|..
gi 16129061 160 EQESFDFFNRTRARYLELAAQDK-SIHTIDATQPLEAVMDAIRTTVTHWVKE 210
Cdd:COG0125 156 EKEDDEFLEKVREGYLELAAKFPeRIIVIDASRPLEEVHEEILKILKERLGL 207
TMPK cd01672
Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the ...
4-205 1.55e-80

Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).


Pssm-ID: 238835  Cd Length: 200  Bit Score: 238.71  E-value: 1.55e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   4 KYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLDIksvGDEVITDKAEVLMFYAARVQLVE 83
Cdd:cd01672   1 MFIVFEGIDGAGKTTLIELLAERLEARG-YEVVLTREPGGTPIGEAIRELLLDP---EDEKMDPRAELLLFAADRAQHVE 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061  84 TVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIEQES 163
Cdd:cd01672  77 EVIKPALARGKIVLSDRFVDSSLAYQGAGRGLGEALIEALNDLATGGLKPDLTILLDIDPEVGLARIEARGRDDRDEQEG 156
                       170       180       190       200
                ....*....|....*....|....*....|....*....|...
gi 16129061 164 FDFFNRTRARYLELAAQDKS-IHTIDATQPLEAVMDAIRTTVT 205
Cdd:cd01672 157 LEFHERVREGYLELAAQEPErIIVIDASQPLEEVLAEILKAIL 199
Thymidylate_kin pfam02223
Thymidylate kinase;
8-200 1.09e-67

Thymidylate kinase;


Pssm-ID: 280400  Cd Length: 184  Bit Score: 205.61  E-value: 1.09e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061     8 IEGLEGAGKTTARNVVVETLEQLGIRdMVFTREPGGTQLAEKLRSLVLDiksvgDEVITDKAEVLMFYAARVQLVETVIK 87
Cdd:pfam02223   1 IEGLDGAGKTTQAELLKERLKEQGIK-VVFTREPGGTPIGEKIRELLLR-----NEELSPLTEALLFAADRIQHLEQKIK 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    88 PALANGTWVIGDRHDLSTQAYQGGGRGiDQHMLATLRDAVLGdfRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFF 167
Cdd:pfam02223  75 PALKQGKTVIVDRYLFSGIAYQGAKGG-DLDLVLSLNPDVPG--KPDLTFLLDVDPEVALKRLRRRGELEKTEFEQLDFL 151
                         170       180       190
                  ....*....|....*....|....*....|...
gi 16129061   168 NRTRARYLELAAQDKSIHTIDATQPLEAVMDAI 200
Cdd:pfam02223 152 RKVRERYLELAKFDERIKIIDASLSIEEVHEEI 184
 
Name Accession Description Interval E-value
tmk PRK00698
thymidylate kinase; Validated
1-209 1.18e-110

thymidylate kinase; Validated


Pssm-ID: 234814  Cd Length: 205  Bit Score: 314.82  E-value: 1.18e-110
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLDiksvGDEVITDKAEVLMFYAARVQ 80
Cdd:PRK00698   1 MRGMFITIEGIDGAGKSTQIELLKELLEQQG-RDVVFTREPGGTPLGEKLRELLLD----PNEEMDDKTELLLFYAARAQ 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIE 160
Cdd:PRK00698  76 HLEEVIKPALARGKWVISDRFIDSSLAYQGGGRGLDIDLLLALNDFALGGFRPDLTLYLDVPPEVGLARIRARGELDRIE 155
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 16129061  161 QESFDFFNRTRARYLELAAQ-DKSIHTIDATQPLEAVMDAIRTTVTHWVK 209
Cdd:PRK00698 156 QEGLDFFERVREGYLELAEKePERIVVIDASQSLEEVHEDILAVIKAWLE 205
DTMP_kinase TIGR00041
dTMP kinase; Function: phosphorylation of DTMP to form DTDP in both de novo and salvage ...
1-200 6.09e-91

dTMP kinase; Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]


Pssm-ID: 161676  Cd Length: 195  Bit Score: 264.61  E-value: 6.09e-91
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061     1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLdikSVGDEVITDKAEVLMFYAARVQ 80
Cdd:TIGR00041   1 MRGMFIVIEGIDGAGKTTQANLLKKLLQENG-YDVLFTREPGGTPIGEKIRELLL---NENDEPLTDKAEALLFAADRHE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDfRPDLTLYLDVTPEVGLKRARARGELDRIE 160
Cdd:TIGR00041  77 HLEDKIKPALAEGKLVISDRYVFSSIAYQGGARGIDEDLVLELNEDALGD-MPDLTIYLDIDPEVALERLRKRGELDREE 155
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 16129061   161 QESFDFFNRTRARYLELAAQDKSIHTIDATQPLEAVMDAI 200
Cdd:TIGR00041 156 FEKLDFFEKVRQRYLELADKEKSIHVIDATNSVEEVEQDI 195
Tmk COG0125
Thymidylate kinase [Nucleotide transport and metabolism];
1-210 1.36e-83

Thymidylate kinase [Nucleotide transport and metabolism];


Pssm-ID: 223203  Cd Length: 208  Bit Score: 246.82  E-value: 1.36e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIrDMVFTREPGGTQLAEKLRSLVLDiksvGDEVITDKAEVLMFYAARVQ 80
Cdd:COG0125   1 MKGMFIVIEGIDGAGKTTQAELLKERLEERGI-KVVLTREPGGTPIGEKIRELLLN----GEEKLSPKAEALLFAADRAQ 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061  81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGEL-DRI 159
Cdd:COG0125  76 HLEEVIKPALKEGKVVICDRYVDSSLAYQGGGRGLDLDWVLALNEFAPGGLKPDLTLYLDVPPEVALERIRKRGELrDRF 155
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|..
gi 16129061 160 EQESFDFFNRTRARYLELAAQDK-SIHTIDATQPLEAVMDAIRTTVTHWVKE 210
Cdd:COG0125 156 EKEDDEFLEKVREGYLELAAKFPeRIIVIDASRPLEEVHEEILKILKERLGL 207
TMPK cd01672
Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the ...
4-205 1.55e-80

Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).


Pssm-ID: 238835  Cd Length: 200  Bit Score: 238.71  E-value: 1.55e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   4 KYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLDIksvGDEVITDKAEVLMFYAARVQLVE 83
Cdd:cd01672   1 MFIVFEGIDGAGKTTLIELLAERLEARG-YEVVLTREPGGTPIGEAIRELLLDP---EDEKMDPRAELLLFAADRAQHVE 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061  84 TVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIEQES 163
Cdd:cd01672  77 EVIKPALARGKIVLSDRFVDSSLAYQGAGRGLGEALIEALNDLATGGLKPDLTILLDIDPEVGLARIEARGRDDRDEQEG 156
                       170       180       190       200
                ....*....|....*....|....*....|....*....|...
gi 16129061 164 FDFFNRTRARYLELAAQDKS-IHTIDATQPLEAVMDAIRTTVT 205
Cdd:cd01672 157 LEFHERVREGYLELAAQEPErIIVIDASQPLEEVLAEILKAIL 199
Thymidylate_kin pfam02223
Thymidylate kinase;
8-200 1.09e-67

Thymidylate kinase;


Pssm-ID: 280400  Cd Length: 184  Bit Score: 205.61  E-value: 1.09e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061     8 IEGLEGAGKTTARNVVVETLEQLGIRdMVFTREPGGTQLAEKLRSLVLDiksvgDEVITDKAEVLMFYAARVQLVETVIK 87
Cdd:pfam02223   1 IEGLDGAGKTTQAELLKERLKEQGIK-VVFTREPGGTPIGEKIRELLLR-----NEELSPLTEALLFAADRIQHLEQKIK 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    88 PALANGTWVIGDRHDLSTQAYQGGGRGiDQHMLATLRDAVLGdfRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFF 167
Cdd:pfam02223  75 PALKQGKTVIVDRYLFSGIAYQGAKGG-DLDLVLSLNPDVPG--KPDLTFLLDVDPEVALKRLRRRGELEKTEFEQLDFL 151
                         170       180       190
                  ....*....|....*....|....*....|...
gi 16129061   168 NRTRARYLELAAQDKSIHTIDATQPLEAVMDAI 200
Cdd:pfam02223 152 RKVRERYLELAKFDERIKIIDASLSIEEVHEEI 184
PRK13973 PRK13973
thymidylate kinase; Provisional
1-204 4.24e-56

thymidylate kinase; Provisional


Pssm-ID: 184429  Cd Length: 213  Bit Score: 177.06  E-value: 4.24e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGiRDMVFTREPGGTQLAEKLRSLVLdikSVGDEVITDKAEVLMFYAARVQ 80
Cdd:PRK13973   1 MRGRFITFEGGEGAGKSTQIRLLAERLRAAG-YDVLVTREPGGSPGAEAIRHVLL---SGAAELYGPRMEALLFAAARDD 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   81 LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARAR---GELD 157
Cdd:PRK13973  77 HVEEVIRPALARGKIVLCDRFIDSTRAYQGVTGNVDPALLAALERVAINGVMPDLTLILDIPAEVGLERAAKRrgsDTPD 156
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 16129061  158 RIEQESFDFFNRTRARYLELAAQD-KSIHTIDATQPLEAVMDAIRTTV 204
Cdd:PRK13973 157 RFEKEDLAFHEKRREAFLQIAAQEpERCVVIDATASPEAVAAEIWAAV 204
PRK13974 PRK13974
thymidylate kinase; Provisional
1-206 1.25e-48

thymidylate kinase; Provisional


Pssm-ID: 172477  Cd Length: 212  Bit Score: 157.90  E-value: 1.25e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGI----RDMVFTREPGGTQLAEKLRSLVLDikSVGDEVITDKAEVLMFYA 76
Cdd:PRK13974   1 MKGKFIVLEGIDGCGKTTQIDHLSKWLPSSGLmpkgAKLIITREPGGTLLGKSLRELLLD--TSKDNSPSPLAELLLYAA 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   77 ARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGEl 156
Cdd:PRK13974  79 DRAQHVSKIIRPALENGDWVISDRFSGSTLAYQGYGRGLDLELIKNLESIATQGLSPDLTFFLEISVEESIRRRKNRKP- 157
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 16129061  157 DRIEQESFDFFNRTrARYLELAAQDKSIHTIDATQPLEAVMDAIRTTVTH 206
Cdd:PRK13974 158 DRIEAEGIEFLERV-AEGFALIAEERNWKVISADQSIETISNEIKETLLN 206
PRK13976 PRK13976
thymidylate kinase; Provisional
5-182 2.09e-33

thymidylate kinase; Provisional


Pssm-ID: 237574  Cd Length: 209  Bit Score: 118.68  E-value: 2.09e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    5 YIVIEGLEGAGKTTARNVVVETLEQL-GIRDMVFTREPGGTQLAEKLRSLVLDIKSVgDEVitdkAEVLMFYAARVQLVE 83
Cdd:PRK13976   2 FITFEGIDGSGKTTQSRLLAEYLSDIyGENNVVLTREPGGTSFNELVRGLLLSLKNL-DKI----SELLLFIAMRREHFV 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   84 TVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLgDFRPDLTLYLDVTPEVGLKRArargELDRIEQES 163
Cdd:PRK13976  77 KVILPALLQGKIVICDRFIDSTIAYQGYGCGVDLSLIRDLNDLVV-DKYPDITFVLDIDIELSLSRA----DKNGYEFMD 151
                        170
                 ....*....|....*....
gi 16129061  164 FDFFNRTRARYLELAAQDK 182
Cdd:PRK13976 152 LEFYDKVRKGFREIVIKNP 170
PRK13975 PRK13975
thymidylate kinase; Provisional
3-204 9.07e-16

thymidylate kinase; Provisional


Pssm-ID: 184430  Cd Length: 196  Bit Score: 72.09  E-value: 9.07e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    3 SKYIVIEGLEGAGKTTARNVVVETLeqlgirDMVFTREPGGTQLAEKLRSlVLDIKSVGDEVITdkaevLMFYAARVQLV 82
Cdd:PRK13975   2 NKFIVFEGIDGSGKTTQAKLLAEKL------NAFWTCEPTDGKIGKLIRE-ILSGSKCDKETLA-----LLFAADRVEHV 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   83 ETvIKPALANGTwVIGDRHDLSTQAYQgGGRGIDQHMLATLRDAVLgdfRPDLTLYLDVTPEVGLKRARARgelDRIEQE 162
Cdd:PRK13975  70 KE-IEEDLKKRD-VVCDRYVYSSIAYQ-SVQGIDEDFIYSINRYAK---KPDLVFLLDVDIEEALKRMETR---DKEIFE 140
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 16129061  163 SFDFFNRTRARYLELAAQDKSIHT-----IDAT-QPLEAVMDAIRTTV 204
Cdd:PRK13975 141 KKEFLKKVQEKYLELANNEKFMPKygfivIDTTnKSIEEVFNEILNKI 188
PLN02924 PLN02924
thymidylate kinase
2-210 1.39e-15

thymidylate kinase


Pssm-ID: 178512  Cd Length: 220  Bit Score: 72.06  E-value: 1.39e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    2 RSKYIVIEGLEGAGKTTARNVVVETLEQLGIrDMVFTREPGGTQLAEKLRSLVLDIKSVGDevitDKAEVLMFYAARVQl 81
Cdd:PLN02924  15 RGALIVLEGLDRSGKSTQCAKLVSFLKGLGV-AAELWRFPDRTTSVGQMISAYLSNKSQLD----DRAIHLLFSANRWE- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   82 VETVIKPALANGTWVIGDRHDLSTQAYQgGGRGIDqhmLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGEldRIEQ 161
Cdd:PLN02924  89 KRSLMERKLKSGTTLVVDRYSYSGVAFS-AAKGLD---LEWCKAPEVGLPAPDLVLYLDISPEEAAERGGYGGE--RYEK 162
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 16129061  162 esFDFFNRTRARYLELaaQDKSIHTIDATQPLEAVMDAIRTTVTHWVKE 210
Cdd:PLN02924 163 --LEFQKKVAKRFQTL--RDSSWKIIDASQSIEEVEKKIREVVLDTVQR 207
PRK07933 PRK07933
thymidylate kinase; Validated
6-181 3.73e-09

thymidylate kinase; Validated


Pssm-ID: 236133  Cd Length: 213  Bit Score: 54.21  E-value: 3.73e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061    6 IVIEGLEGAGKTTARNVVVETLEQLGIRDMVFT-----REPGGTQLAEKLRSlvldikSVGDEVITDKAEVLMF----YA 76
Cdd:PRK07933   3 IAIEGVDGAGKRTLTEALRAALEARGRSVATLAfprygRSVHADLAAEALHG------RHGDLADSVYAMATLFaldrAG 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   77 ARVQLVEtvikpALANGTWVIGDRHDLSTQAYQGG--GRGIDQHMLATLRDAVLGDF---RPDLTLYLDVTPEVGLKRAR 151
Cdd:PRK07933  77 ARDELAG-----LLAAHDVVILDRYVASNAAYSAArlHQDADGEAVAWVAELEFGRLglpVPDLQVLLDVPVELAAERAR 151
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 16129061  152 ARGE------LDRIEQESfDFFNRTRARYLELAAQD 181
Cdd:PRK07933 152 RRAAqdadraRDAYERDD-GLQQRTGAVYAELAAQG 186
dNK cd01673
Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to ...
5-154 1.01e-05

Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.


Pssm-ID: 238836  Cd Length: 193  Bit Score: 44.14  E-value: 1.01e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   5 YIVIEGLEGAGKTTarnvvvetleqlgirdmvFTREpggtqLAEKLRSLVL---DIKSVGDEVITDKaevlmFY------ 75
Cdd:cd01673   1 VIVVEGNIGAGKST------------------LAKE-----LAEHLGYEVVpepVEPDVEGNPFLEK-----FYedpkrw 52
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061  76 AARVQL--------VETVIKPALANGTWVIGDRHDLS------TQAYQGGGRGIDQHMLATLRDAVLGDF-RPDLTLYLD 140
Cdd:cd01673  53 AFPFQLyfllsrlkQYKDALEHLSTGQGVILERSIFSdrvfaeANLKEGGIMKTEYDLYNELFDNLIPELlPPDLVIYLD 132
                       170
                ....*....|....
gi 16129061 141 VTPEVGLKRARARG 154
Cdd:cd01673 133 ASPETCLKRIKKRG 146
PRK06761 PRK06761
hypothetical protein; Provisional
1-32 5.13e-03

hypothetical protein; Provisional


Pssm-ID: 180682  Cd Length: 282  Bit Score: 36.66  E-value: 5.13e-03
                         10        20        30
                 ....*....|....*....|....*....|..
gi 16129061    1 MRSKYIVIEGLEGAGKTTARNVVVETLEQLGI 32
Cdd:PRK06761   1 MMTKLIIIEGLPGFGKSTTAKMLNDILSQNGI 32
CoaE COG0237
Dephospho-CoA kinase [Coenzyme transport and metabolism];
6-172 8.92e-03

Dephospho-CoA kinase [Coenzyme transport and metabolism];


Pssm-ID: 223315  Cd Length: 201  Bit Score: 35.72  E-value: 8.92e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061   6 IVIEGLEGAGKTTarnvVVETLEQLGI---------RDMVFTREPGGTQLAEK------LRSLVLDIKSVGDEVITDKAE 70
Cdd:COG0237   5 IGLTGGIGSGKST----VAKILAELGFpvidaddvaREVVEPGGEALQEIAERfgleilDEDGGLDRRKLREKVFNDPEA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129061  71 VlmfyaarvQLVETVIKPALANGTWVIgdrhdlsTQAYQGGGRGIDqhmLATLRDAvLGDFRPDLTLYLDVTPEVGLKRA 150
Cdd:COG0237  81 R--------LKLEKILHPLIRAEIKVV-------IDGARSPYVVLE---IPLLFEA-GGEKYFDKVIVVYAPPEIRLERL 141
                       170       180
                ....*....|....*....|..
gi 16129061 151 RARGELDRIEQESFDFFNRTRA 172
Cdd:COG0237 142 MKRDGLDEEDAEARLASQRDLE 163
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH