NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|162135920|ref|NP_415904|]
View 

copper-containing amine oxidase [Escherichia coli str. K-12 substr. MG1655]

Protein Classification

primary-amine oxidase (domain architecture ID 11487393)

primary-amine oxidase can deaminate short-chain primary amines, but is insensitive to monoamine oxidase (MAO) inhibitors

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
tynA PRK14696
tyramine oxidase; Provisional
37-757 0e+00

tyramine oxidase; Provisional


:

Pssm-ID: 184793 [Multi-domain]  Cd Length: 721  Bit Score: 1581.76  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  37 MVPMDKTLKEFGADVQWDDYAQLFTLIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDNKAWVSDTFINDVFQSGLDQT 116
Cdd:PRK14696   1 MVPLDKTLKEFGADVQWDDYAQTFTIIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDGKAWVSDTFINDVFQSGLDQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 117 FQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQPRKADVIMLDGKHIIEAV 196
Cdd:PRK14696  81 FQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLKEPDKEAVWAFALENKPVDQPRKADVIMLDGKHVIEAV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 197 VDLQNNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDGLKQDARLLKVI 276
Cdd:PRK14696 161 VDLQNNKVLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAALKKRGITDVKKVITTPLTVGYFDGKDGLKQDARLLKVV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 277 SYLDVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPMTARPFDGRDRVAPAVKPMQIIEPEGKNYTITGDMIHWR 356
Cdd:PRK14696 241 SYLDVGDGNYWAHPIENLVAVVDLEQKKIIKIEEGPVVPVPMTARPYDGRDRVAPAVKPLQIIEPEGKNYTITGDTIHWR 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 357 NWDFHLSMNSRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 436
Cdd:PRK14696 321 NWDFHLSLDSRVGPMLSTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 437 VLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERRELVVRWISTVGNYDYIFDWIFHENGTIGIDAGA 516
Cdd:PRK14696 401 VLLDETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERRELVVRWISTVGNYDYIFDWVFHENGTIGIDAGA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 517 TGIEAVKGVKAKTMHDETAKDDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVN 596
Cdd:PRK14696 481 TGIEAVKGVKAKTMHDETAKEDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVN 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 597 QYNIGNEQDAAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGAQFAPDEWIYHRLSFMDKQLWVTRYHPG 676
Cdd:PRK14696 561 QYNIGNEQDAAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGANFAPDEWIYHRLSFMDKQLWVTRYHPG 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 677 ERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTLGALKKD 756
Cdd:PRK14696 641 ERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTLGLLKKD 720

                 .
gi 162135920 757 K 757
Cdd:PRK14696 721 Q 721
 
Name Accession Description Interval E-value
tynA PRK14696
tyramine oxidase; Provisional
37-757 0e+00

tyramine oxidase; Provisional


Pssm-ID: 184793 [Multi-domain]  Cd Length: 721  Bit Score: 1581.76  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  37 MVPMDKTLKEFGADVQWDDYAQLFTLIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDNKAWVSDTFINDVFQSGLDQT 116
Cdd:PRK14696   1 MVPLDKTLKEFGADVQWDDYAQTFTIIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDGKAWVSDTFINDVFQSGLDQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 117 FQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQPRKADVIMLDGKHIIEAV 196
Cdd:PRK14696  81 FQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLKEPDKEAVWAFALENKPVDQPRKADVIMLDGKHVIEAV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 197 VDLQNNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDGLKQDARLLKVI 276
Cdd:PRK14696 161 VDLQNNKVLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAALKKRGITDVKKVITTPLTVGYFDGKDGLKQDARLLKVV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 277 SYLDVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPMTARPFDGRDRVAPAVKPMQIIEPEGKNYTITGDMIHWR 356
Cdd:PRK14696 241 SYLDVGDGNYWAHPIENLVAVVDLEQKKIIKIEEGPVVPVPMTARPYDGRDRVAPAVKPLQIIEPEGKNYTITGDTIHWR 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 357 NWDFHLSMNSRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 436
Cdd:PRK14696 321 NWDFHLSLDSRVGPMLSTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 437 VLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERRELVVRWISTVGNYDYIFDWIFHENGTIGIDAGA 516
Cdd:PRK14696 401 VLLDETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERRELVVRWISTVGNYDYIFDWVFHENGTIGIDAGA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 517 TGIEAVKGVKAKTMHDETAKDDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVN 596
Cdd:PRK14696 481 TGIEAVKGVKAKTMHDETAKEDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVN 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 597 QYNIGNEQDAAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGAQFAPDEWIYHRLSFMDKQLWVTRYHPG 676
Cdd:PRK14696 561 QYNIGNEQDAAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGANFAPDEWIYHRLSFMDKQLWVTRYHPG 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 677 ERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTLGALKKD 756
Cdd:PRK14696 641 ERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTLGLLKKD 720

                 .
gi 162135920 757 K 757
Cdd:PRK14696 721 Q 721
TynA COG3733
Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport and catabolism];
20-757 0e+00

Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226256 [Multi-domain]  Cd Length: 654  Bit Score: 998.51  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  20 LSFAWQAPVFAHGGEAHMVPMDKTLKEfgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdnkaw 99
Cdd:COG3733    1 LSFAWQAPVFAHCGESHMVPMTVTAKE----------------------------------------------------- 27
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 100 vsdtfindvfqsgldqtfqvekRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQP 179
Cdd:COG3733   28 ----------------------RSHPLDPLTADEIKQAVEIVRAEADFKKNFAFTEVTLLEPDKQEVLAFRLENKPIERK 85
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 180 RKADVIMLDGKHIIEAVVDLQNNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGY 259
Cdd:COG3733   86 ALAVVYELDGKGIYEAVVDLDNNKVLSWQPIKDAHPMITLDEFASVENIVRNDPRFIEACKKRGITDMDQVIVDPWTAGY 165
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 260 FDgKDGLKQDARLLKVISYLDVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPMtARPFDGRDRVAPAV---KPM 336
Cdd:COG3733  166 FD-EEGLKGRRRALKVMWYRDVEDDNYYAHPIEGLVAIVDLEKKKVVRIDDHPVVPLPM-KRANYGRERIGKALgpvKPI 243
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 337 QIIEPEGKNYTITGDMIHWRNWDFHLSMNSRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGD 416
Cdd:COG3733  244 QIIQPEGKSFTITGDEISWQNWRFRIGMNPREGLVLSDVSYNDNGNKRPVLYRASLVEMVVPYGDPDPGHYFKNAFDSGE 323
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 417 YGMGTLTSPIARGKDAPSNAVLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTER-RELVVRWISTVGN 495
Cdd:COG3733  324 YGLGTLTSPLALGDCAGSNIVLLDATFANYTGEPMTIPNAICIHEEDAGVLWKHQDFRSPNVETRRaRGLVVSWIATVAN 403
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 496 YDYIFDWIFHENGTIGIDAGATGIEAVKgVKAKTMHDETakddtrYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVA 575
Cdd:COG3733  404 YDYGFYWIFHQDGTIEFEAKLTGIINTK-AIAEGQPDPT------YGTLVDPNVVGHTHQHFFNARLDMDVDGERNSVVE 476
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 576 MDPVVKPNTAGGPRTSTMQVNQYNIGNEQDAAQKFDPGTIR--LLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGAQFAp 653
Cdd:COG3733  477 MNVVGAPITKGNPYGNAFQVEETVLKNEKDACRDADPKTSRywKIANPNKKNYLGNPVAYKLIPGHNPTPPVAEGSQVR- 555
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 654 dewiyHRLSFMDKQLWVTRYHPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEW 733
Cdd:COG3733  556 -----HRAGFATKHLWVTPYHPGERYPAGDYPNQSAGGKGLPEYIKDDRSLDNEDLVVWHTFGITHVPRPEDWPVMPVEW 630
                        730       740
                 ....*....|....*....|....
gi 162135920 734 VHTLLKPWNFFDETPTLGALKKDK 757
Cdd:COG3733  631 AGFLLKPRGFFDRNPAIDLPRKDN 654
Cu_amine_oxid pfam01179
Copper amine oxidase, enzyme domain; Copper amine oxidases are a ubiquitous and novel group of ...
337-750 0e+00

Copper amine oxidase, enzyme domain; Copper amine oxidases are a ubiquitous and novel group of quinoenzymes that catalyze the oxidative deamination of primary amines to the corresponding aldehydes, with concomitant reduction of molecular oxygen to hydrogen peroxide. The enzymes are dimers of identical 70-90 kDa subunits, each of which contains a single copper ion and a covalently bound cofactor formed by the post-translational modification of a tyrosine side chain to 2,4,5-trihydroxyphenylalanine quinone (TPQ). This family corresponds to the catalytic domain of the enzyme.


Pssm-ID: 334418  Cd Length: 403  Bit Score: 532.02  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  337 QIIEPEGKNYTITGDMIHWRNWDFHLSMNSRVGPMISTVTYNDngtkRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGD 416
Cdd:pfam01179   2 NIVQPEGPSFTVDGNYVEWQGWSFRVGFNPREGLVLHDVRYKG----RRILYRLSLSEMVVPYGDPDPPHHRKAAFDSGE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  417 YGMGTLTSPIARGKDAPSNAVLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMG-QPNVSTERRELVVRWISTVGN 495
Cdd:pfam01179  78 YGLGRLANSLVLGCDCPGNITYLDAVFADSDGEPVTIKNAICIFEEDAGPLWKHTDYRtGRAEVRRNRRLVVRSISTVGN 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  496 YDYIFDWIFHENGTIGIDAGATGIEAVKGVkaktmhdeTAKDDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVA 575
Cdd:pfam01179 158 YDYIFDWIFYQDGTIEVEVRATGILSTAFI--------DPGETSPYGTRVAPGVLGSNHQHLFNFRLDLDIDGTKNSVVE 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  576 MDPVVKPNTAGGPRTSTMQVNQYNIGNEQDAAQKFDPGTIR--LLSNPNKENRMGNPVSYQIIPyAGGTHPVAKgaqfaP 653
Cdd:pfam01179 230 VDVVPWPDGPENPRGNAFTVERTVLETEKEAARDLDPSTPRywKIVNPNKKNKSGNPVGYRLVP-GAHQPLLAD-----P 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  654 DEWIYHRLSFMDKQLWVTRYHPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEW 733
Cdd:pfam01179 304 DSSVAKRAAFARHHLWVTKYKDDELYAAGDYNNQSRGPVGLADWIADNESIENEDLVLWVTFGFTHIPRPEDFPVMPVEH 383
                         410
                  ....*....|....*..
gi 162135920  734 VHTLLKPWNFFDETPTL 750
Cdd:pfam01179 384 VGFLLRPFNFFDRNPSL 400
 
Name Accession Description Interval E-value
tynA PRK14696
tyramine oxidase; Provisional
37-757 0e+00

tyramine oxidase; Provisional


Pssm-ID: 184793 [Multi-domain]  Cd Length: 721  Bit Score: 1581.76  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  37 MVPMDKTLKEFGADVQWDDYAQLFTLIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDNKAWVSDTFINDVFQSGLDQT 116
Cdd:PRK14696   1 MVPLDKTLKEFGADVQWDDYAQTFTIIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDGKAWVSDTFINDVFQSGLDQT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 117 FQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQPRKADVIMLDGKHIIEAV 196
Cdd:PRK14696  81 FQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLKEPDKEAVWAFALENKPVDQPRKADVIMLDGKHVIEAV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 197 VDLQNNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDGLKQDARLLKVI 276
Cdd:PRK14696 161 VDLQNNKVLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAALKKRGITDVKKVITTPLTVGYFDGKDGLKQDARLLKVV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 277 SYLDVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPMTARPFDGRDRVAPAVKPMQIIEPEGKNYTITGDMIHWR 356
Cdd:PRK14696 241 SYLDVGDGNYWAHPIENLVAVVDLEQKKIIKIEEGPVVPVPMTARPYDGRDRVAPAVKPLQIIEPEGKNYTITGDTIHWR 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 357 NWDFHLSMNSRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 436
Cdd:PRK14696 321 NWDFHLSLDSRVGPMLSTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 437 VLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERRELVVRWISTVGNYDYIFDWIFHENGTIGIDAGA 516
Cdd:PRK14696 401 VLLDETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERRELVVRWISTVGNYDYIFDWVFHENGTIGIDAGA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 517 TGIEAVKGVKAKTMHDETAKDDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVN 596
Cdd:PRK14696 481 TGIEAVKGVKAKTMHDETAKEDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVN 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 597 QYNIGNEQDAAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGAQFAPDEWIYHRLSFMDKQLWVTRYHPG 676
Cdd:PRK14696 561 QYNIGNEQDAAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGANFAPDEWIYHRLSFMDKQLWVTRYHPG 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 677 ERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTLGALKKD 756
Cdd:PRK14696 641 ERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTLGLLKKD 720

                 .
gi 162135920 757 K 757
Cdd:PRK14696 721 Q 721
TynA COG3733
Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport and catabolism];
20-757 0e+00

Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 226256 [Multi-domain]  Cd Length: 654  Bit Score: 998.51  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  20 LSFAWQAPVFAHGGEAHMVPMDKTLKEfgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdnkaw 99
Cdd:COG3733    1 LSFAWQAPVFAHCGESHMVPMTVTAKE----------------------------------------------------- 27
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 100 vsdtfindvfqsgldqtfqvekRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQP 179
Cdd:COG3733   28 ----------------------RSHPLDPLTADEIKQAVEIVRAEADFKKNFAFTEVTLLEPDKQEVLAFRLENKPIERK 85
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 180 RKADVIMLDGKHIIEAVVDLQNNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGY 259
Cdd:COG3733   86 ALAVVYELDGKGIYEAVVDLDNNKVLSWQPIKDAHPMITLDEFASVENIVRNDPRFIEACKKRGITDMDQVIVDPWTAGY 165
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 260 FDgKDGLKQDARLLKVISYLDVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPMtARPFDGRDRVAPAV---KPM 336
Cdd:COG3733  166 FD-EEGLKGRRRALKVMWYRDVEDDNYYAHPIEGLVAIVDLEKKKVVRIDDHPVVPLPM-KRANYGRERIGKALgpvKPI 243
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 337 QIIEPEGKNYTITGDMIHWRNWDFHLSMNSRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGD 416
Cdd:COG3733  244 QIIQPEGKSFTITGDEISWQNWRFRIGMNPREGLVLSDVSYNDNGNKRPVLYRASLVEMVVPYGDPDPGHYFKNAFDSGE 323
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 417 YGMGTLTSPIARGKDAPSNAVLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTER-RELVVRWISTVGN 495
Cdd:COG3733  324 YGLGTLTSPLALGDCAGSNIVLLDATFANYTGEPMTIPNAICIHEEDAGVLWKHQDFRSPNVETRRaRGLVVSWIATVAN 403
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 496 YDYIFDWIFHENGTIGIDAGATGIEAVKgVKAKTMHDETakddtrYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVA 575
Cdd:COG3733  404 YDYGFYWIFHQDGTIEFEAKLTGIINTK-AIAEGQPDPT------YGTLVDPNVVGHTHQHFFNARLDMDVDGERNSVVE 476
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 576 MDPVVKPNTAGGPRTSTMQVNQYNIGNEQDAAQKFDPGTIR--LLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGAQFAp 653
Cdd:COG3733  477 MNVVGAPITKGNPYGNAFQVEETVLKNEKDACRDADPKTSRywKIANPNKKNYLGNPVAYKLIPGHNPTPPVAEGSQVR- 555
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 654 dewiyHRLSFMDKQLWVTRYHPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEW 733
Cdd:COG3733  556 -----HRAGFATKHLWVTPYHPGERYPAGDYPNQSAGGKGLPEYIKDDRSLDNEDLVVWHTFGITHVPRPEDWPVMPVEW 630
                        730       740
                 ....*....|....*....|....
gi 162135920 734 VHTLLKPWNFFDETPTLGALKKDK 757
Cdd:COG3733  631 AGFLLKPRGFFDRNPAIDLPRKDN 654
tynA PRK11504
tyramine oxidase; Provisional
123-750 0e+00

tyramine oxidase; Provisional


Pssm-ID: 236919 [Multi-domain]  Cd Length: 647  Bit Score: 580.32  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 123 PHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFAlENKPVDqpRKADVIMLD--GKHIIEAVVDLQ 200
Cdd:PRK11504  13 SHPLDPLTAAEIEAAVAILRAEGLLGESTRFVSIELAEPPKAEVLAFD-PGDPID--RRAFVVLYDraTGKTYEAVVSLT 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 201 NNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDglKQDARLLKVISYL- 279
Cdd:PRK11504  90 AGEVVSWEEIPGVQPPILLEEFEECEEVVRADPRWQAALAKRGITDFDLVMVDPWSAGYFGEPE--ERGRRLARGLAFVr 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 280 DVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPMTARPFDgRDRVAPA---VKPMQIIEPEGKNYTITGDMIHWR 356
Cdd:PRK11504 168 ADPGDNGYARPIEGLVAVVDLNTMEVLRVEDHGVVPIPAEDGNYD-PEFIPPLrtdLKPLEITQPEGPSFTVDGNEVEWQ 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 357 NWDFHLSMNSRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPSNA 436
Cdd:PRK11504 247 KWSFRVGFNPREGLVLHQVSYDDGGRERPILYRASLSEMVVPYGDPSPTHYWKNAFDAGEYGLGRLANSLELGCDCLGEI 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 437 VLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTER-RELVVRWISTVGNYDYIFDWIFHENGTIGIDAG 515
Cdd:PRK11504 327 RYFDAVLADSDGEPYTIKNAICMHEEDYGILWKHTDFRTGSAEVRRsRRLVISFFATVGNYDYGFYWYFYQDGTIEFEVK 406
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 516 ATGIEAVKGVKAKTmhdetakdDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQV 595
Cdd:PRK11504 407 LTGIVFTAAVPPGE--------TPPYGTLVAPGLYAPNHQHFFNARLDMDVDGPGNSVYEVNSVPVPMGPDNPHGNAFYT 478
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 596 NQYNIGNEQDAAQKFDPGTIR--LLSNPNKENRMGNPVSYQIIPyaGGTHPVAkgaqFAPDEWIYHRLSFMDKQLWVTRY 673
Cdd:PRK11504 479 RETLLETESEAARDADPSTGRywKIVNPNKKNRLGEPVAYKLVP--GGNPPLL----ADPGSSIRQRAGFATHHLWVTPY 552
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 162135920 674 HPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFFDETPTL 750
Cdd:PRK11504 553 DPDERYAAGDYPNQSAGGDGLPAYIAADRSIENTDVVLWYTFGITHVPRPEDWPVMPVDYAGFKLKPVGFFDRNPAL 629
Cu_amine_oxid pfam01179
Copper amine oxidase, enzyme domain; Copper amine oxidases are a ubiquitous and novel group of ...
337-750 0e+00

Copper amine oxidase, enzyme domain; Copper amine oxidases are a ubiquitous and novel group of quinoenzymes that catalyze the oxidative deamination of primary amines to the corresponding aldehydes, with concomitant reduction of molecular oxygen to hydrogen peroxide. The enzymes are dimers of identical 70-90 kDa subunits, each of which contains a single copper ion and a covalently bound cofactor formed by the post-translational modification of a tyrosine side chain to 2,4,5-trihydroxyphenylalanine quinone (TPQ). This family corresponds to the catalytic domain of the enzyme.


Pssm-ID: 334418  Cd Length: 403  Bit Score: 532.02  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  337 QIIEPEGKNYTITGDMIHWRNWDFHLSMNSRVGPMISTVTYNDngtkRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGD 416
Cdd:pfam01179   2 NIVQPEGPSFTVDGNYVEWQGWSFRVGFNPREGLVLHDVRYKG----RRILYRLSLSEMVVPYGDPDPPHHRKAAFDSGE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  417 YGMGTLTSPIARGKDAPSNAVLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMG-QPNVSTERRELVVRWISTVGN 495
Cdd:pfam01179  78 YGLGRLANSLVLGCDCPGNITYLDAVFADSDGEPVTIKNAICIFEEDAGPLWKHTDYRtGRAEVRRNRRLVVRSISTVGN 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  496 YDYIFDWIFHENGTIGIDAGATGIEAVKGVkaktmhdeTAKDDTRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVA 575
Cdd:pfam01179 158 YDYIFDWIFYQDGTIEVEVRATGILSTAFI--------DPGETSPYGTRVAPGVLGSNHQHLFNFRLDLDIDGTKNSVVE 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  576 MDPVVKPNTAGGPRTSTMQVNQYNIGNEQDAAQKFDPGTIR--LLSNPNKENRMGNPVSYQIIPyAGGTHPVAKgaqfaP 653
Cdd:pfam01179 230 VDVVPWPDGPENPRGNAFTVERTVLETEKEAARDLDPSTPRywKIVNPNKKNKSGNPVGYRLVP-GAHQPLLAD-----P 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  654 DEWIYHRLSFMDKQLWVTRYHPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEW 733
Cdd:pfam01179 304 DSSVAKRAAFARHHLWVTKYKDDELYAAGDYNNQSRGPVGLADWIADNESIENEDLVLWVTFGFTHIPRPEDFPVMPVEH 383
                         410
                  ....*....|....*..
gi 162135920  734 VHTLLKPWNFFDETPTL 750
Cdd:pfam01179 384 VGFLLRPFNFFDRNPSL 400
PLN02566 PLN02566
amine oxidase (copper-containing)
123-751 2.22e-102

amine oxidase (copper-containing)


Pssm-ID: 215306 [Multi-domain]  Cd Length: 646  Bit Score: 328.37  E-value: 2.22e-102
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 123 PHPLNALTADEIKQAVEIVKASADFK-PNTRFTEISLLPPDKEAV--WAFALENKPVDQPRKADVIMLDGKHIIEAVVDL 199
Cdd:PLN02566  21 YHPLDPLNPQEINKIRLIVQKSHLGNlPNLTFHFLDLEEPEKRDVlkWLSSNPSNKSPPPRRAKVVVRAGGETYELIVDL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 200 QNNKLLSwQPIKDAHG---MVLLDDFASVQnIINNSEEFAAAVKKRGItDAKKVITTPLTVGYFdgkdGLKQDARLLKVI 276
Cdd:PLN02566 101 ATGSITS-SRVYTGHGyppLTFIELFQASK-LPLKYPKFKKSILRRGL-NISEVSCIPFTVGWY----GETVTKRALKIS 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 277 SYLDVGDGNYWAHPIENLVAVVDLEQKKIVKIEEGPVVPVPmTARPFDGRDRVAPAVKPMQIIEpegKNYTITGDMIHWR 356
Cdd:PLN02566 174 CFYRGGSVNVFARPIEGISILIDVDSMQIIKYSDRFRAPLP-KAEGTDFRTKHKPFSFPCNVSD---SGFTILGHRVKWA 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 357 NWDFHLSMNSRVGPMISTVTYNDNGTK--RKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSPIARGKDAPS 434
Cdd:PLN02566 250 NWDFHVGFDARAGVTISTASVFDAKVKrfRRVLYRGHVSETFVPYMDPTSEWYFRTFMDIGEFGFGRSAVTLQPLIDCPA 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 435 NAVLLNETIADYTGVPMEIPRAIAVFERYAGP-EYKHQEMGQPNVSTERRE----LVVRWISTVGNYDYIFDWIFHENGT 509
Cdd:PLN02566 330 NAVYLDGYVAGADGQAQKMTNVICIFERYSGDvAFRHTEINVPGRVIRSGEpeisLVVRMVATLGNYDYILDWEFKKSGS 409
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 510 IGIDAGATGIEAVKGVkAKTMHDETAKDdtRYGTLIDHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGG-- 587
Cdd:PLN02566 410 IKVGVDLTGVLEMKAT-SYTNNDQITKD--VYGTLVAENTIAVNHDHFLTYYLDLDVDGNGNSFVKAKLQTARVTAVNas 486
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 588 -PRTSTMQVNQYNIGNEQDAAQKF--DPGTIrLLSNPNKENRMGNPVSYQIIPyaggTHPVAkgAQFAPDEWIYHRLSFM 664
Cdd:PLN02566 487 sPRKSYWTVVKETAKTEAEGRIRLgsEPAEL-LIVNPNKKTKLGNQVGYRLIT----GQPVT--SLLSDDDYPQIRAAYT 559
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920 665 DKQLWVTRYHPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEEWPIMPTEWVHTLLKPWNFF 744
Cdd:PLN02566 560 KYQVWVTAYNKSERWAGGFYADRSRGDDGLAVWSSRNREIENKDIVLWYTVGFHHIPYQEDFPVMPTLHGGFELRPANFF 639

                 ....*..
gi 162135920 745 DETPTLG 751
Cdd:PLN02566 640 ESNPLLR 646
Cu_amine_oxidN2 pfam02727
Copper amine oxidase, N2 domain; This domain is the first or second structural domain in ...
124-210 1.87e-33

Copper amine oxidase, N2 domain; This domain is the first or second structural domain in copper amine oxidases, it is known as the N2 domain. Its function is uncertain. The catalytic domain can be found in pfam01179. Copper amine oxidases are a ubiquitous and novel group of quinoenzymes that catalyze the oxidative deamination of primary amines to the corresponding aldehydes, with concomitant reduction of molecular oxygen to hydrogen peroxide. The enzymes are dimers of identical 70-90 kDa subunits, each of which contains a single copper ion and a covalently bound cofactor formed by the post-translational modification of a tyrosine side chain to 2,4,5-trihydroxyphenylalanine quinone (TPQ).


Pssm-ID: 335060 [Multi-domain]  Cd Length: 87  Bit Score: 123.28  E-value: 1.87e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  124 HPLNALTADEIKQAVEIVKASA-DFKPNTRFTEISLLPPDKEAVWAF-ALENKPvdQPRKADVIMLDGKHIIEAVVDLQN 201
Cdd:pfam02727   1 HPLDALTAFEINKVVSILKSSAlFTLKDNTFFSVELLEPDKAAVLAFlDKGNPP--PPREADVVIFFGGQPHENVVDLAV 78

                  ....*....
gi 162135920  202 NKLLSWQPI 210
Cdd:pfam02727  79 GPLPSPRYM 87
Cu_amine_oxidN3 pfam02728
Copper amine oxidase, N3 domain; This domain is the second or third structural domain in ...
216-317 2.83e-30

Copper amine oxidase, N3 domain; This domain is the second or third structural domain in copper amine oxidases, it is known as the N3 domain. Its function is uncertain. The catalytic domain can be found in pfam01179. Copper amine oxidases are a ubiquitous and novel group of quinoenzymes that catalyze the oxidative deamination of primary amines to the corresponding aldehydes, with concomitant reduction of molecular oxygen to hydrogen peroxide. The enzymes are dimers of identical 70-90 kDa subunits, each of which contains a single copper ion and a covalently bound cofactor formed by the post-translational modification of a tyrosine side chain to 2,4,5-trihydroxyphenylalanine quinone (TPQ).


Pssm-ID: 308383 [Multi-domain]  Cd Length: 101  Bit Score: 114.73  E-value: 2.83e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162135920  216 MVLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDGlkqDARLLKVISYLDVGDGNYWAHPIENLV 295
Cdd:pfam02728   2 PVLLEEYDDIEDIIKEDPQFNEALKSRGIFNLDDVYCDPWTVGPRGEKSE---GRRLTKALCYYRDGGVNFYAHPIEGLE 78
                          90       100
                  ....*....|....*....|...
gi 162135920  296 AVVDLEQKKIVKIEEGPV-VPVP 317
Cdd:pfam02728  79 LLVDHDAKDVIEITDQKVrYPGP 101
Cu_amine_oxidN1 pfam07833
Copper amine oxidase N-terminal domain; Copper amine oxidases catalyze the oxidative ...
37-109 1.35e-12

Copper amine oxidase N-terminal domain; Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.


Pssm-ID: 311673  Cd Length: 93  Bit Score: 63.77  E-value: 1.35e-12
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 162135920   37 MVPMDKTLKEFGADVQWDDYAQLFTLIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDNKAWVSDTFINDVF 109
Cdd:pfam07833   6 LVPLRAIAEALGAKVEWDGKTKTVTITKGGTTIKLTIGSNTATVNGQEITLDVPPVLINGRTYVPLRFVAEAL 78
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH