NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16272691|ref|NP_438909|]
View 

diaminopimelate epimerase [Haemophilus influenzae Rd KW20]

Protein Classification

diaminopimelate epimerase (domain architecture ID 11478756)

diaminopimelate epimerase catalyzes the stereoinversion of LL-2,6-diaminoheptanedioate (L,L-DAP) to meso-diaminoheptanedioate (meso-DAP)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
dapF PRK00450
diaminopimelate epimerase; Provisional
1-274 3.42e-159

diaminopimelate epimerase; Provisional


:

Pssm-ID: 234768 [Multi-domain]  Cd Length: 274  Bit Score: 443.09  E-value: 3.42e-159
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691    1 MQFSKMHGLGNDFVVVDGVTQnvFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:PRK00450   3 MKFTKMHGLGNDFVVIDARTQ--ELTPELARKLCDRHFGIGADGLLLVEPPSSPGADFRMRIFNADGSEAEMCGNGARCF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKF-EKNYILrtDIQTVLCGAVSMGNPH 159
Cdd:PRK00450  81 ARFLYEKGLTNKTEIRVETLAGIIEAEVEDDGLVTVDMGEPRFEPAEIPLAEEDViEKEYIL--GGQTVEVTAVSMGNPH 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  160 CVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQ 239
Cdd:PRK00450 159 AVIFVDDVDAADVEELGPLLENHPRFPEGVNVNFVQVVDRDHIRLRVYERGVGETLACGTGACAAAVAAIRLGLLDRKVT 238
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 16272691  240 VDLPGGSLMIEWNGVGHpLYMTGEATHIYDGFITL 274
Cdd:PRK00450 239 VHLPGGDLTIEWKGDGH-VYMTGPATLVFDGEIDL 272
 
Name Accession Description Interval E-value
dapF PRK00450
diaminopimelate epimerase; Provisional
1-274 3.42e-159

diaminopimelate epimerase; Provisional


Pssm-ID: 234768 [Multi-domain]  Cd Length: 274  Bit Score: 443.09  E-value: 3.42e-159
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691    1 MQFSKMHGLGNDFVVVDGVTQnvFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:PRK00450   3 MKFTKMHGLGNDFVVIDARTQ--ELTPELARKLCDRHFGIGADGLLLVEPPSSPGADFRMRIFNADGSEAEMCGNGARCF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKF-EKNYILrtDIQTVLCGAVSMGNPH 159
Cdd:PRK00450  81 ARFLYEKGLTNKTEIRVETLAGIIEAEVEDDGLVTVDMGEPRFEPAEIPLAEEDViEKEYIL--GGQTVEVTAVSMGNPH 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  160 CVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQ 239
Cdd:PRK00450 159 AVIFVDDVDAADVEELGPLLENHPRFPEGVNVNFVQVVDRDHIRLRVYERGVGETLACGTGACAAAVAAIRLGLLDRKVT 238
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 16272691  240 VDLPGGSLMIEWNGVGHpLYMTGEATHIYDGFITL 274
Cdd:PRK00450 239 VHLPGGDLTIEWKGDGH-VYMTGPATLVFDGEIDL 272
DapF COG0253
Diaminopimelate epimerase [Amino acid transport and metabolism];
1-272 3.99e-152

Diaminopimelate epimerase [Amino acid transport and metabolism];


Pssm-ID: 223331 [Multi-domain]  Cd Length: 272  Bit Score: 425.15  E-value: 3.99e-152
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:COG0253   1 MEFSKMHGLGNDFIVVDEFDKKDEETPELARALCDRHFGIGADGVLFVEPPRSPGADFHLRIFNSDGSEAEMCGNGARCF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKNYILRTdiQTVLCGAVSMGNPHC 160
Cdd:COG0253  81 ARFLAERGLVKKKEISVETLAGILKVKVHDDNTVSVDMGLPSFKPAEIPLLEEKVEEQYGLGE--ETVTFYAVSMGNPHL 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691 161 VVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQV 240
Cdd:COG0253 159 VIFVDDVETANLEELGPLLESHELFPEGVNVGFVQVLSRDAIRLRVYERGAGETLACGTGACAAAVVAARLGLLDRKVTV 238
                       250       260       270
                ....*....|....*....|....*....|..
gi 16272691 241 DLPGGSLMIEWNGVGHPLYMTGEATHIYDGFI 272
Cdd:COG0253 239 HLPGGTLEIEWKDDGKPVYMTGPATRVAEGKL 270
DapF TIGR00652
diaminopimelate epimerase; [Amino acid biosynthesis, Aspartate family]
1-274 6.15e-144

diaminopimelate epimerase; [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 273197 [Multi-domain]  Cd Length: 267  Bit Score: 404.41  E-value: 6.15e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691     1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEaPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:TIGR00652   1 MRFTKMHGLGNDFVLVDSFDAELVKEPELARQVCDRHTGIGADGLLFVE-PGSPEADYKMRIFNSDGSEAEMCGNGIRCF 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691    81 ARFVTLKGLTnKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN-YILRTDIQtvlcgAVSMGNPH 159
Cdd:TIGR00652  80 AKFVYEHGGK-KKDIRVETLAGLIVLEVKEENKVKVDMGEPDFKPAEIPLTVWGFEEPeVLLFGEVL-----AVDTGNPH 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   160 CVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQ 239
Cdd:TIGR00652 154 LVVFVDDVETLNLTILGPLLEYHERFPEGVNVNFVQVKGDDTIRLRTYERGEGETLACGTGACASAAAALLLGGTNKKVT 233
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 16272691   240 VDLPGGSLMIEWNGVGHpLYMTGEATHIYDGFITL 274
Cdd:TIGR00652 234 VHLPGGNLEIEWKEDGT-VYMTGPAVRVFRGVLFL 267
DAP_epimerase pfam01678
Diaminopimelate epimerase; Diaminopimelate epimerase contains two domains of the same alpha ...
152-267 1.99e-47

Diaminopimelate epimerase; Diaminopimelate epimerase contains two domains of the same alpha/beta fold, both contained in this family.


Pssm-ID: 307689  Cd Length: 119  Bit Score: 153.99  E-value: 1.99e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   152 AVSMGNPHCVVQVDDIQTANVEQ--LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGI 229
Cdd:pfam01678   2 AKMHGNPHDVVFVDDVEGENLLTpeLGPALCHRHFFPGADNVLFVQPSGEEDIKMRIFNRDGSETLACGNGAVACFAAAV 81
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 16272691   230 MQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHI 267
Cdd:pfam01678  82 YLGGTKKSVLVETLGGDLEIEIKDDGHKIVMMGPAVLV 119
 
Name Accession Description Interval E-value
dapF PRK00450
diaminopimelate epimerase; Provisional
1-274 3.42e-159

diaminopimelate epimerase; Provisional


Pssm-ID: 234768 [Multi-domain]  Cd Length: 274  Bit Score: 443.09  E-value: 3.42e-159
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691    1 MQFSKMHGLGNDFVVVDGVTQnvFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:PRK00450   3 MKFTKMHGLGNDFVVIDARTQ--ELTPELARKLCDRHFGIGADGLLLVEPPSSPGADFRMRIFNADGSEAEMCGNGARCF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKF-EKNYILrtDIQTVLCGAVSMGNPH 159
Cdd:PRK00450  81 ARFLYEKGLTNKTEIRVETLAGIIEAEVEDDGLVTVDMGEPRFEPAEIPLAEEDViEKEYIL--GGQTVEVTAVSMGNPH 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  160 CVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQ 239
Cdd:PRK00450 159 AVIFVDDVDAADVEELGPLLENHPRFPEGVNVNFVQVVDRDHIRLRVYERGVGETLACGTGACAAAVAAIRLGLLDRKVT 238
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 16272691  240 VDLPGGSLMIEWNGVGHpLYMTGEATHIYDGFITL 274
Cdd:PRK00450 239 VHLPGGDLTIEWKGDGH-VYMTGPATLVFDGEIDL 272
DapF COG0253
Diaminopimelate epimerase [Amino acid transport and metabolism];
1-272 3.99e-152

Diaminopimelate epimerase [Amino acid transport and metabolism];


Pssm-ID: 223331 [Multi-domain]  Cd Length: 272  Bit Score: 425.15  E-value: 3.99e-152
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:COG0253   1 MEFSKMHGLGNDFIVVDEFDKKDEETPELARALCDRHFGIGADGVLFVEPPRSPGADFHLRIFNSDGSEAEMCGNGARCF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKNYILRTdiQTVLCGAVSMGNPHC 160
Cdd:COG0253  81 ARFLAERGLVKKKEISVETLAGILKVKVHDDNTVSVDMGLPSFKPAEIPLLEEKVEEQYGLGE--ETVTFYAVSMGNPHL 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691 161 VVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQV 240
Cdd:COG0253 159 VIFVDDVETANLEELGPLLESHELFPEGVNVGFVQVLSRDAIRLRVYERGAGETLACGTGACAAAVVAARLGLLDRKVTV 238
                       250       260       270
                ....*....|....*....|....*....|..
gi 16272691 241 DLPGGSLMIEWNGVGHPLYMTGEATHIYDGFI 272
Cdd:COG0253 239 HLPGGTLEIEWKDDGKPVYMTGPATRVAEGKL 270
DapF TIGR00652
diaminopimelate epimerase; [Amino acid biosynthesis, Aspartate family]
1-274 6.15e-144

diaminopimelate epimerase; [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 273197 [Multi-domain]  Cd Length: 267  Bit Score: 404.41  E-value: 6.15e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691     1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEaPYDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:TIGR00652   1 MRFTKMHGLGNDFVLVDSFDAELVKEPELARQVCDRHTGIGADGLLFVE-PGSPEADYKMRIFNSDGSEAEMCGNGIRCF 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691    81 ARFVTLKGLTnKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKN-YILRTDIQtvlcgAVSMGNPH 159
Cdd:TIGR00652  80 AKFVYEHGGK-KKDIRVETLAGLIVLEVKEENKVKVDMGEPDFKPAEIPLTVWGFEEPeVLLFGEVL-----AVDTGNPH 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   160 CVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQ 239
Cdd:TIGR00652 154 LVVFVDDVETLNLTILGPLLEYHERFPEGVNVNFVQVKGDDTIRLRTYERGEGETLACGTGACASAAAALLLGGTNKKVT 233
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 16272691   240 VDLPGGSLMIEWNGVGHpLYMTGEATHIYDGFITL 274
Cdd:TIGR00652 234 VHLPGGNLEIEWKEDGT-VYMTGPAVRVFRGVLFL 267
PLN02536 PLN02536
diaminopimelate epimerase
26-274 1.99e-96

diaminopimelate epimerase


Pssm-ID: 178151 [Multi-domain]  Cd Length: 267  Bit Score: 283.97  E-value: 1.99e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   26 TPETIRRLANRHCGIGFDQLLIVEaPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVT-LKGLTNKKDISVSTQKGNM 104
Cdd:PLN02536  12 TPEQAVKLCDRNFGIGADGVIFAM-PGVNGTDYTMRIFNSDGSEPEMCGNGIRCFARFIAeLENLQGKNSYKIHTGAGLI 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  105 VLTVKDDNQIRVNMGEPIWEPAKIPF----TANKFEKNYILRTDIQTVLCGAVSMGNPHCVVQVDD---IQTANVEQLGP 177
Cdd:PLN02536  91 IPEMQADGQVKVDMGEPILKGPEVPTklaaTKDGAVVQAELDVDGKTWLVTCVSMGNPHCVTFGEKelkVDDLPLEKIGP 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  178 LLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNVQVDLPGGSLMIEWNGVGHP 257
Cdd:PLN02536 171 KFEHHEMFPARTNTEFVQVVSRSHLKMRVWERGAGATLACGTGACALVVAAVLEGRADRNCTVDLPGGPLEIEWRESDNH 250
                        250
                 ....*....|....*..
gi 16272691  258 LYMTGEATHIYDGFITL 274
Cdd:PLN02536 251 IYMTGPAELVFYGEIRL 267
PRK13577 PRK13577
diaminopimelate epimerase; Provisional
1-270 2.99e-72

diaminopimelate epimerase; Provisional


Pssm-ID: 184158 [Multi-domain]  Cd Length: 281  Bit Score: 223.03  E-value: 2.99e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691    1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPyDPELDFHYRIFNADGSEVSQCGNGARCF 80
Cdd:PRK13577   1 MKFYKYHALGNDYLVIDPRDAPFDPSADAIRRICHRHFGVGSDGILFGPLP-SEGADFGLRIFNPDGSEAEKSGNGLRIF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   81 ARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQ-IRVNMGEPIWEPAKIPFTANKFEK-NYILRTDIQTVLCGAVSMGNP 158
Cdd:PRK13577  80 SRYLWDQGLVDDEPFTIETKGGIVECQVLDAGRtIQVEMGKVSFGSTDIPVAGEDREVlNEKLDVDGRRLTYCAATIGNP 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691  159 HCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLNNNV 238
Cdd:PRK13577 160 HCVVLLDEISEELARELGPLIETHPRFPNRTNVQFLKVLDRNTIQIEIWERGAGYTLASGSSSCAAAAVAHRLGLCDSSI 239
                        250       260       270
                 ....*....|....*....|....*....|..
gi 16272691  239 QVDLPGGSLMIEWNGVGHPLyMTGEATHIYDG 270
Cdd:PRK13577 240 TVHMPGGQIDIEIKDDFHVS-MTGPVTKVAEG 270
DAP_epimerase pfam01678
Diaminopimelate epimerase; Diaminopimelate epimerase contains two domains of the same alpha ...
152-267 1.99e-47

Diaminopimelate epimerase; Diaminopimelate epimerase contains two domains of the same alpha/beta fold, both contained in this family.


Pssm-ID: 307689  Cd Length: 119  Bit Score: 153.99  E-value: 1.99e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691   152 AVSMGNPHCVVQVDDIQTANVEQ--LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGI 229
Cdd:pfam01678   2 AKMHGNPHDVVFVDDVEGENLLTpeLGPALCHRHFFPGADNVLFVQPSGEEDIKMRIFNRDGSETLACGNGAVACFAAAV 81
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 16272691   230 MQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHI 267
Cdd:pfam01678  82 YLGGTKKSVLVETLGGDLEIEIKDDGHKIVMMGPAVLV 119
DAP_epimerase pfam01678
Diaminopimelate epimerase; Diaminopimelate epimerase contains two domains of the same alpha ...
3-123 9.60e-42

Diaminopimelate epimerase; Diaminopimelate epimerase contains two domains of the same alpha/beta fold, both contained in this family.


Pssm-ID: 307689  Cd Length: 119  Bit Score: 139.35  E-value: 9.60e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16272691     3 FSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPydPELDFHYRIFNADGSEVSQCGNGA-RCFA 81
Cdd:pfam01678   1 FAKMHGNPHDVVFVDDVEGENLLTPELGPALCHRHFFPGADNVLFVQPS--GEEDIKMRIFNRDGSETLACGNGAvACFA 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 16272691    82 RFVTLKGltNKKDISVSTQKGNMVLTVKDDNQIRVNMGEPIW 123
Cdd:pfam01678  79 AAVYLGG--TKKSVLVETLGGDLEIEIKDDGHKIVMMGPAVL 118
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH