NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|18079339|ref|NP_542364|]
View 

aconitate hydratase, mitochondrial precursor [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
aconitase_mito super family cl36873
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
45-775 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


The actual alignment was detected with superfamily member TIGR01340:

Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1233.98  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    45 YDLLEKNINIVRKRLN-RPLTLSEKIVYGHLDDPAN----QEIE--RGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPK 117
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   118 VAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPN 197
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   198 GGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISC 277
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   278 TGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDH---LVPDPGCQYDQVIEINLNELKPHINGPFT 354
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTGQYSffkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   355 PDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   435 ILRDVGGIVLANACGPCIGQWDRKD-IKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDF 513
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   514 LTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDS-SGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKC 592
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSPnPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   593 TTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNaVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSRE 672
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYD-LDGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   673 HAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAP---GKPLKCVIKHPNGTQ 749
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 18079339   750 ETILLNHTFNETQIEWFRAGSALNRM 775
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
45-775 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1233.98  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    45 YDLLEKNINIVRKRLN-RPLTLSEKIVYGHLDDPAN----QEIE--RGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPK 117
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   118 VAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPN 197
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   198 GGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISC 277
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   278 TGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDH---LVPDPGCQYDQVIEINLNELKPHINGPFT 354
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTGQYSffkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   355 PDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   435 ILRDVGGIVLANACGPCIGQWDRKD-IKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDF 513
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   514 LTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDS-SGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKC 592
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSPnPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   593 TTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNaVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSRE 672
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYD-LDGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   673 HAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAP---GKPLKCVIKHPNGTQ 749
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 18079339   750 ETILLNHTFNETQIEWFRAGSALNRM 775
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
61-777 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 899.90  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   61 RPLTLSEKIVYGHLDDPanqEIERGKTyLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTI-HCDHlieaqvggekD 139
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  140 LRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAG 219
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  220 IPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  300 NHRMKKYLSKTGRTDIAnlaeefkDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGtvaekegwPLDIRV 379
Cdd:PRK07229 227 DERTREFLKAQGREDDW-------VELLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVDQ 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  380 GLIGSCTNSSYEDMGRSAAVAKqalAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwdrkD 459
Cdd:PRK07229 292 VLIGSCTNSSYEDLMRAASILK---GKKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM----G 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  460 IKKGEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKfNPETdfLTGKDGKKFKLEAPDadelprsDFDP 539
Cdd:PRK07229 365 QAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRT--LALENGEYPKLEEPE-------GFAV 433
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  540 GQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDkwdgkDLEDLQILIKVKGKCTTDHISAAGP-WLKFRGHLDNISNNLL 618
Cdd:PRK07229 434 DDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFVF 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  619 IGAINIENGKAnsvrnavtQEFGPvpdtaryykkhgirWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETN 698
Cdd:PRK07229 509 EGVDNTFPERA--------KEQGG--------------GIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKAN 566
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18079339  699 LKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLKCVIKHPNgtqETILLNHTFNETQIEWFRAGSALNRMKE 777
Cdd:PRK07229 567 LINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKD---EEIEVRHTLSERQIEILLAGGALNLIKK 642
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
95-505 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 872.53  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  95 RVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIH 174
Cdd:cd01584   1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 175 QIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGI 254
Cdd:cd01584  81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 255 LTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFK-DHLVPDPGCQ 333
Cdd:cd01584 161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKdDLLVADEGAE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 334 YDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQ 413
Cdd:cd01584 241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 414 FTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSP 493
Cdd:cd01584 321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                       410
                ....*....|..
gi 18079339 494 EIVTALAIAGTL 505
Cdd:cd01584 401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
30-777 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 719.50  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  30 AKVAMSHFEPSEYIRYDLLEkninIVRKRLNRPLTLSEKIVYGHLDDPAN------QEIERGK------TYLRLRPDRVA 97
Cdd:COG1048   4 KARKTLTVGGKTYYYYDLPK----LEESGKISKLPYSLKILLENLLRGEDgteehiEALARWLpsgkpeKEIAFRPARVV 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  98 MQDATAQMAmlQFISSGLPKVA-------------VPSTIHCDHLIEAQVGG-----EKDLRRAKDINQEVYNFLATA-G 158
Cdd:COG1048  80 MQDFTGVPA--VVDLAAMRDAMvelggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAaK 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 159 AKYGVGFWRPGSGIIHQIILENYA-----YPGVL----LIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKV 229
Cdd:COG1048 158 AFYNFRVVPPGTGIIHQVNLEYLAkvvwaKPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEV 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 230 IGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSK 309
Cdd:COG1048 238 VGVKLTGKLPEGVTATDLVLTVTGMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRL 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 310 TGRTDIAN-LAEEFKD-----HLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVG----------------TV 367
Cdd:COG1048 318 TGRSEEQVaLVEAYAKaqglwYDPADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAenfekilreieikrvySL 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 368 AEKEGWPLDIRVGLIGSCTNSSYEDMGRSAA-VAKQALAHGLKCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVL 444
Cdd:COG1048 398 LGKELGDGKVVIAAITSCTNTSNPDVLIAAGlLAKKAVEKGLKVKPwvKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIV 477
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 445 ANACGPCIGQWDR--KDIKKG-EKNTIVT----SYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKFNPETDFL--- 514
Cdd:COG1048 478 GYGCTTCIGNSGPlpEEIEKAiNDNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgtd 556
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 515 -TGKDGKKFKLEAPDADELPRSDFDPGQDTYQHP--------PKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQ-- 583
Cdd:COG1048 557 nDGKPVYLKDIWPSTEEIAEAVGKAVKPEMFRKEyadvfkwnAIEVPEGPLYDWPNISTYIRLPPFFDGMGAEPKPIKga 636
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 584 -ILIKVKGKCTTDHISAAG--------PWLKFRGHLDNISNNLLIGAINIENGKAN------SVRN---------AVTQE 639
Cdd:COG1048 637 rVLAKLGDSITTDHISPAGsikadspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNemvpgeggyTIHQP 716
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 640 FGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIH 719
Cdd:COG1048 717 SGEIYDAAMKYKEEGIPLVVVAGKNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLG 796
                       810       820       830       840       850       860
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 18079339 720 PVDKLTIQ--GLKDFAPGKPLKCVIKHPNGTQETI-LLNHTFNETQIEWFRAGSALNRMKE 777
Cdd:COG1048 797 LDGEETIDigGLENLKPGATVTVTVTRGDGPVEEFpVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
67-503 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 548.55  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    67 EKIVYGHLDDPANQEIERgktylrlRPDRVAMQDATAQMAMLQFISSGLPK-----------VAVPSTIHCDHlieaqvG 135
Cdd:pfam00330   1 EKIWDAHLVEELDGSLLY-------IPDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDR------D 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   136 GEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNggglggicigvggA--- 211
Cdd:pfam00330  68 LDKNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTT-------------Hggl 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   212 ----------DAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMA 281
Cdd:pfam00330 135 galafgvggsEAEHVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRA 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   282 TICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIAnLAEEFKD-----HLVPDPGCQYDQVIEINLNELKPHINGPFTPD 356
Cdd:pfam00330 215 TICNMAIEYGATAGLFPPDETTFEYLRATGRPEAP-KGEAYDKavalwRLASDPGAVYDKVVEIDLSTIEPMVTGPTSPQ 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   357 LAHPVAD-------------------VGTVAEKEGWPL---DIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKS-- 412
Cdd:pfam00330 294 DAVPLSElvpdpafaddvereaaeraLEYMGLEPGTPLedgKVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVAPgv 373
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   413 QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGRNdaNPETHAFVTS 492
Cdd:pfam00330 374 KASVVPGSEVVRAYAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPGE--RCVSSSNRNFEGRQ--GPGGRTHLAS 447
                         490
                  ....*....|.
gi 18079339   493 PEIVTALAIAG 503
Cdd:pfam00330 448 PALVAAAAIAG 458
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
45-775 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1233.98  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    45 YDLLEKNINIVRKRLN-RPLTLSEKIVYGHLDDPAN----QEIE--RGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPK 117
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   118 VAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPN 197
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   198 GGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISC 277
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   278 TGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDH---LVPDPGCQYDQVIEINLNELKPHINGPFT 354
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTGQYSffkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   355 PDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   435 ILRDVGGIVLANACGPCIGQWDRKD-IKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDF 513
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   514 LTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDS-SGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKC 592
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSPnPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   593 TTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNaVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSRE 672
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYD-LDGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   673 HAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAP---GKPLKCVIKHPNGTQ 749
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 18079339   750 ETILLNHTFNETQIEWFRAGSALNRM 775
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
61-777 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 899.90  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   61 RPLTLSEKIVYGHLDDPanqEIERGKTyLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTI-HCDHlieaqvggekD 139
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  140 LRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAG 219
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  220 IPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  300 NHRMKKYLSKTGRTDIAnlaeefkDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGtvaekegwPLDIRV 379
Cdd:PRK07229 227 DERTREFLKAQGREDDW-------VELLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVDQ 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  380 GLIGSCTNSSYEDMGRSAAVAKqalAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwdrkD 459
Cdd:PRK07229 292 VLIGSCTNSSYEDLMRAASILK---GKKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM----G 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  460 IKKGEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKfNPETdfLTGKDGKKFKLEAPDadelprsDFDP 539
Cdd:PRK07229 365 QAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRT--LALENGEYPKLEEPE-------GFAV 433
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  540 GQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDkwdgkDLEDLQILIKVKGKCTTDHISAAGP-WLKFRGHLDNISNNLL 618
Cdd:PRK07229 434 DDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFVF 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  619 IGAINIENGKAnsvrnavtQEFGPvpdtaryykkhgirWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETN 698
Cdd:PRK07229 509 EGVDNTFPERA--------KEQGG--------------GIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKAN 566
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18079339  699 LKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLKCVIKHPNgtqETILLNHTFNETQIEWFRAGSALNRMKE 777
Cdd:PRK07229 567 LINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKD---EEIEVRHTLSERQIEILLAGGALNLIKK 642
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
95-505 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 872.53  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  95 RVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIH 174
Cdd:cd01584   1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 175 QIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGI 254
Cdd:cd01584  81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 255 LTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFK-DHLVPDPGCQ 333
Cdd:cd01584 161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKdDLLVADEGAE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 334 YDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQ 413
Cdd:cd01584 241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 414 FTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSP 493
Cdd:cd01584 321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                       410
                ....*....|..
gi 18079339 494 EIVTALAIAGTL 505
Cdd:cd01584 401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
30-777 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 719.50  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  30 AKVAMSHFEPSEYIRYDLLEkninIVRKRLNRPLTLSEKIVYGHLDDPAN------QEIERGK------TYLRLRPDRVA 97
Cdd:COG1048   4 KARKTLTVGGKTYYYYDLPK----LEESGKISKLPYSLKILLENLLRGEDgteehiEALARWLpsgkpeKEIAFRPARVV 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  98 MQDATAQMAmlQFISSGLPKVA-------------VPSTIHCDHLIEAQVGG-----EKDLRRAKDINQEVYNFLATA-G 158
Cdd:COG1048  80 MQDFTGVPA--VVDLAAMRDAMvelggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAaK 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 159 AKYGVGFWRPGSGIIHQIILENYA-----YPGVL----LIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKV 229
Cdd:COG1048 158 AFYNFRVVPPGTGIIHQVNLEYLAkvvwaKPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEV 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 230 IGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSK 309
Cdd:COG1048 238 VGVKLTGKLPEGVTATDLVLTVTGMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRL 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 310 TGRTDIAN-LAEEFKD-----HLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVG----------------TV 367
Cdd:COG1048 318 TGRSEEQVaLVEAYAKaqglwYDPADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAenfekilreieikrvySL 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 368 AEKEGWPLDIRVGLIGSCTNSSYEDMGRSAA-VAKQALAHGLKCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVL 444
Cdd:COG1048 398 LGKELGDGKVVIAAITSCTNTSNPDVLIAAGlLAKKAVEKGLKVKPwvKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIV 477
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 445 ANACGPCIGQWDR--KDIKKG-EKNTIVT----SYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKFNPETDFL--- 514
Cdd:COG1048 478 GYGCTTCIGNSGPlpEEIEKAiNDNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgtd 556
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 515 -TGKDGKKFKLEAPDADELPRSDFDPGQDTYQHP--------PKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQ-- 583
Cdd:COG1048 557 nDGKPVYLKDIWPSTEEIAEAVGKAVKPEMFRKEyadvfkwnAIEVPEGPLYDWPNISTYIRLPPFFDGMGAEPKPIKga 636
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 584 -ILIKVKGKCTTDHISAAG--------PWLKFRGHLDNISNNLLIGAINIENGKAN------SVRN---------AVTQE 639
Cdd:COG1048 637 rVLAKLGDSITTDHISPAGsikadspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNemvpgeggyTIHQP 716
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 640 FGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIH 719
Cdd:COG1048 717 SGEIYDAAMKYKEEGIPLVVVAGKNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLG 796
                       810       820       830       840       850       860
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 18079339 720 PVDKLTIQ--GLKDFAPGKPLKCVIKHPNGTQETI-LLNHTFNETQIEWFRAGSALNRMKE 777
Cdd:COG1048 797 LDGEETIDigGLENLKPGATVTVTVTRGDGPVEEFpVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
67-503 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 548.55  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    67 EKIVYGHLDDPANQEIERgktylrlRPDRVAMQDATAQMAMLQFISSGLPK-----------VAVPSTIHCDHlieaqvG 135
Cdd:pfam00330   1 EKIWDAHLVEELDGSLLY-------IPDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDR------D 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   136 GEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNggglggicigvggA--- 211
Cdd:pfam00330  68 LDKNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTT-------------Hggl 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   212 ----------DAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMA 281
Cdd:pfam00330 135 galafgvggsEAEHVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRA 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   282 TICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIAnLAEEFKD-----HLVPDPGCQYDQVIEINLNELKPHINGPFTPD 356
Cdd:pfam00330 215 TICNMAIEYGATAGLFPPDETTFEYLRATGRPEAP-KGEAYDKavalwRLASDPGAVYDKVVEIDLSTIEPMVTGPTSPQ 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   357 LAHPVAD-------------------VGTVAEKEGWPL---DIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKS-- 412
Cdd:pfam00330 294 DAVPLSElvpdpafaddvereaaeraLEYMGLEPGTPLedgKVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVAPgv 373
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   413 QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGRNdaNPETHAFVTS 492
Cdd:pfam00330 374 KASVVPGSEVVRAYAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPGE--RCVSSSNRNFEGRQ--GPGGRTHLAS 447
                         490
                  ....*....|.
gi 18079339   493 PEIVTALAIAG 503
Cdd:pfam00330 448 PALVAAAAIAG 458
Aconitase cd01351
Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and ...
95-505 2.12e-169

Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Aconitase catalytic domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. Aconitase, in its active form, contains a 4Fe-4S iron-sulfur cluster; three cysteine residues have been shown to be ligands of the 4Fe-4S cluster. This is the Aconitase core domain, including structural domains 1, 2 and 3, which binds the Fe-S cluster. The aconitase family also contains the following proteins: - Iron-responsive element binding protein (IRE-BP), a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 153129  Cd Length: 389  Bit Score: 493.55  E-value: 2.12e-169
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  95 RVAMQDATAQMAMLQFISSGLP-KVAVPSTIHCDHLIEAQVggekdlrrAKDINQEVYNFLATAGAKYGVGFWRPGSGII 173
Cdd:cd01351   1 RVMLQDATGPMAMKAFEILAALgKVADPSQIACVHDHAVQL--------EKPVNNEGHKFLSFFAALQGIAFYRPGVGII 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 174 HQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAG 253
Cdd:cd01351  73 HQIMVENLALPGDLLVGSDSHTTSYGGLGAISTGAGGGDVAFVMAGGPAWLKKPEVVGVNLTGKLSPGVTGKDVVLKLGG 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 254 ILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDHLVPDPGCQ 333
Cdd:cd01351 153 IVGVDGVLNRIVEFYGEGVSSLSIEDRLTICNMMAELGATTGIFPEDKTTLKWLEATGRPLLKNLWLAFPEELLADEGAE 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 334 YDQVIEINLNELKPHINGPFTPDLAHPVADVGTvaekegwpLDIRVGLIGSCTNSSYEDMGRSAAVAKQALahgLKCKSQ 413
Cdd:cd01351 233 YDQVIEIDLSELEPDISGPNRPDDAVSVSEVEG--------TKIDQVLIGSCTNNRYSDMLAAAKLLKGAK---VAPGVR 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 414 FTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdiKKGEKNTIVTSYNRNFTGRNDANPEtHAFVTSP 493
Cdd:cd01351 302 LIVTPGSRMVYATLSREGYYEILVDSGARILPPGCGPCMGNGAR---LVADGEVGVSSGNRNFPGRLGTYER-HVYLASP 377
                       410
                ....*....|..
gi 18079339 494 EIVTALAIAGTL 505
Cdd:cd01351 378 ELAAATAIAGKI 389
acon_putative TIGR01342
aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins ...
64-777 2.02e-124

aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]


Pssm-ID: 130409 [Multi-domain]  Cd Length: 658  Bit Score: 387.42  E-value: 2.02e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    64 TLSEKIVYGHLddpANQEIERGKTyLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVP-STIHCDHLIEaqvggEKDLRR 142
Cdd:TIGR01342   1 TLAEKIIDDHL---VEGDLEPGEE-IAIEIDQTLSQDATGTMCWLEFEALEMDEVKTElAAQYCDHNML-----QFDFKN 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   143 AKDinqevYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPW 222
Cdd:TIGR01342  72 ADD-----HKFLMSAAGKFGAWFSKPGNGICHNVHKENFAAPGKTLLGSDSHTPTAGGLGMLAIGAGGIDIAAAMAGEAF 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   223 ELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHR 302
Cdd:TIGR01342 147 YLEMPEIVGVHLEGELPEWATAKDIILELLRRLSVKGGLGKIFEYFGEGVEELSVPERATITNMGAELGATSSIFPSDDI 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   303 MKKYLSKTGRTDianlaeEFKDhLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVgtvaekEGWPLDIRVglI 382
Cdd:TIGR01342 227 TEAWLAAFDRED------DFVD-LLADADAEYADEIEIDLSDLEPLIAEPHMPDNVVPVREI------AGIEVDQVM--I 291
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   383 GSCTNSSYEDMGRSAAVAKQALAHGlkcKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwdrkDIKK 462
Cdd:TIGR01342 292 GSCTNGAFEDLLPAAKLLEGREVHK---DTEFAVAPGSKQALELIAQEGALAEFLAAGANFLEAACGACIGI----GFAP 364
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   463 GEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLkFNPETdfLTGKDGKkfkLEAPDAdELPRS---DFDP 539
Cdd:TIGR01342 365 ASDGVSLRSFNRNFEGRA-GIEDAKVYLASPETATAAAIAGEI-IDPRD--LADDEGD---LEAIGF-EMGEKfpgGYDA 436
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   540 GqDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFdkwdGKDLEDlQILIKVKGKCTTDHISAAGP-WLKFRGHLDNISNNLL 618
Cdd:TIGR01342 437 A-DIDIIPKEEREDDDIIKGPNIKPLPEFDPL----GADIEG-ETALIMEDNITTDHIIPAGAdILKFRSNIEAISEFTL 510
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   619 igainiengkansvrNAVTQEFGPVPDTARYYKKHGIrwvVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETN 698
Cdd:TIGR01342 511 ---------------HRIDDEFAERAKAADEKGKAGI---IIAGENYGQGSSREHAALAPMFLGVEAVIAKSFARIHHAN 572
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   699 LKKQGLLPLTFADPSDYNKIHPVDKLTIQG--LKDFAPGKPLKCVIKHpngTQETILLNHTFNETQIEWFRAGSALNRMK 776
Cdd:TIGR01342 573 LFNFGILPLEFDNEEDYAKFELGDDIEIPDdlAAALADGEDEFTINKN---DDEEALATLDASEREKEILAAGGKLNLIK 649

                  .
gi 18079339   777 E 777
Cdd:TIGR01342 650 N 650
AcnA_Mitochon_Swivel cd01578
Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and ...
587-735 7.62e-109

Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 238810 [Multi-domain]  Cd Length: 149  Bit Score: 328.27  E-value: 7.62e-109
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 587 KVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYG 666
Cdd:cd01578   1 KAKGKCTTDHISAAGPWLKYRGHLDNISNNLLIGAINAENGKANSVKNQVTGEYGPVPDTARDYKAHGIKWVVIGDENYG 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18079339 667 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPG 735
Cdd:cd01578  81 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYDKIHPDDKVDILGLTDFAPG 149
AcnA_Bact cd01585
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
94-505 3.16e-108

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Bacterial Aconitase-like catalytic domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This distinct subfamily is found only in bacteria and Archaea. Its exact characteristics are not known.


Pssm-ID: 153135  Cd Length: 380  Bit Score: 335.57  E-value: 3.16e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  94 DRVAMQDATAQMAMLQFISSGLPKVAVP-STIHCDHLIEAQvggekDLRRAKDinqevYNFLATAGAKYGVGFWRPGSGI 172
Cdd:cd01585   1 DQTLTQDATGTMAYLQFEAMGVDRVRTElSVSYVDHNTLQT-----DFENADD-----HRFLQTVAARYGIYFSRPGNGI 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 173 IHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVA 252
Cdd:cd01585  71 CHQVHLERFAVPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYYIPMPKVVGVRLTGELPPWVTAKDVILELL 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 253 GILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDianlaeEFKDhLVPDPGC 332
Cdd:cd01585 151 RRLTVKGGVGKIFEYTGPGVATLSVPERATITNMGAELGATTSIFPSDERTREFLAAQGRED------DWVE-LAADADA 223
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 333 QYDQVIEINLNELKPHINGPFTPDLAHPVADVGtvaekegwPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGlkcKS 412
Cdd:cd01585 224 EYDEEIEIDLSELEPLIARPHSPDNVVPVREVA--------GIKVDQVAIGSCTNSSYEDLMTVAAILKGRRVHP---HV 292
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 413 QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDrkdiKKGEKNTIVTSYNRNFTGRNdANPETHAFVTS 492
Cdd:cd01585 293 SMVVAPGSKQVLEMLARNGALADLLAAGARILESACGPCIGMGQ----APPTGGVSVRTFNRNFEGRS-GTKDDLVYLAS 367
                       410
                ....*....|...
gi 18079339 493 PEIVTALAIAGTL 505
Cdd:cd01585 368 PEVAAAAALTGVI 380
acnA PRK12881
aconitate hydratase AcnA;
92-780 4.50e-77

aconitate hydratase AcnA;


Pssm-ID: 237246 [Multi-domain]  Cd Length: 889  Bit Score: 266.80  E-value: 4.50e-77
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   92 RPDRVAMQDATAQ------MAMLQFISS--GLPKV---AVPSTIHCDHLIEAQVGGEKD-LRRAKDI----NQEVYNFLA 155
Cdd:PRK12881  82 VPARVVMQDFTGVpalvdlAAMRDAAAEagGDPAKinpLVPVDLVVDHSVAVDYFGQKDaLDLNMKIefqrNAERYQFLK 161
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  156 -TAGAKYGVGFWRPGSGIIHQIILE--------------NYAYPGVLlIGTDSHTP--NGGGLGGICIGVGGADAVdvMA 218
Cdd:PRK12881 162 wGMQAFDNFRVVPPGTGIMHQVNLEylarvvhtkeddgdTVAYPDTL-VGTDSHTTmiNGIGVLGWGVGGIEAEAV--ML 238
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  219 GIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFP 298
Cdd:PRK12881 239 GQPVYMLIPDVVGVELTGKLREGVTATDLVLTVTEMLRKEGVVGKFVEFFGEGVASLTLGDRATIANMAPEYGATMGFFP 318
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  299 YNHRMKKYLSKTGRTD--IAnLAEEFKDH----LVPDPGCQYDQVIEINLNELKPHINGP---------------FTPDL 357
Cdd:PRK12881 319 VDEQTLDYLRLTGRTEaqIA-LVEAYAKAqglwGDPKAEPRYTRTLELDLSTVAPSLAGPkrpqdrialgnvksaFSDLF 397
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  358 AHPVADVGTVAEKEGWPL------DIRVGLIGSCTNSSYEDMGRSAA-VAKQALAHGLKCKS--QFTITPGSEQIRATIE 428
Cdd:PRK12881 398 SKPVAENGFAKKAQTSNGvdlpdgAVAIAAITSCTNTSNPSVLIAAGlLAKKAVERGLTVKPwvKTSLAPGSKVVTEYLE 477
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  429 RDGYAQILRDVG-GIVlANACGPCIGQWD------RKDIKKGE-KNTIVTSYNRNFTGRNDANPEThAFVTSPEIVTALA 500
Cdd:PRK12881 478 RAGLLPYLEKLGfGIV-GYGCTTCIGNSGpltpeiEQAITKNDlVAAAVLSGNRNFEGRIHPNIKA-NFLASPPLVVAYA 555
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  501 IAGTLKFNPETDFL-TGKDGKKFKLE-----APDADELPRSDFDPgqDTYQH---PPKDSSGQRVDVS-PTSQRLQ---- 566
Cdd:PRK12881 556 LAGTVRRDLMTEPLgKGKDGRPVYLKdiwpsSAEIDALVAFAVDP--EDFRKnyaEVFKGSELWAAIEaPDGPLYDwdpk 633
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  567 ---LLEP--FDKWDG-----KDLEDLQILIKVKGKCTTDHIS---------AAGPWLKFRGHLDNISN------------ 615
Cdd:PRK12881 634 styIRRPpfFDFSMGpaasiATVKGARPLAVLGDSITTDHISpagaikadsPAGKYLKENGVPKADFNsygsrrgnhevm 713
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  616 -----------NLLIGAinIENGkanSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGR 684
Cdd:PRK12881 714 mrgtfanvrikNLMIPG--KEGG---LTLHQPSGEVLSIYDAAMRYQAAGTPLVVIAGEEYGTGSSRDWAAKGTRLLGVK 788
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  685 AIITKSFARIHETNLKKQGLLPLTF--ADPSDYNKIHPVDKLTIQGL-KDFAPGKPLKCVIKHPNGTQETILLNHTFnET 761
Cdd:PRK12881 789 AVIAESFERIHRSNLVGMGVLPLQFkgGDSRQSLGLTGGETFDIEGLpGEIKPRQDVTLVIHRADGSTERVPVLCRI-DT 867
                        810       820
                 ....*....|....*....|.
gi 18079339  762 QIE--WFRAGSALNRMkeLQQ 780
Cdd:PRK12881 868 PIEvdYYKAGGILPYV--LRQ 886
PRK09277 PRK09277
aconitate hydratase AcnA;
92-774 2.29e-75

aconitate hydratase AcnA;


Pssm-ID: 236445 [Multi-domain]  Cd Length: 888  Bit Score: 261.98  E-value: 2.29e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   92 RPDRVAMQDAT--------AQM--AMLQF------ISsglPKVAVPSTIhcDHLIEAQVGGEKD-LRRAKDI----NQEV 150
Cdd:PRK09277  83 RPARVVMQDFTgvpavvdlAAMrdAIADLggdpakIN---PLVPVDLVI--DHSVQVDYFGTPDaFEKNVELeferNEER 157
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  151 YNFLatagaKYGVGFWR------PGSGIIHQIILE-------------NYAYPGVLlIGTDSHTPnggglggicigvgga 211
Cdd:PRK09277 158 YQFL-----KWGQKAFDnfrvvpPGTGICHQVNLEylapvvwtredgeLVAYPDTL-VGTDSHTT--------------- 216
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  212 dAVD----------------VMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSI 275
Cdd:PRK09277 217 -MINglgvlgwgvggieaeaAMLGQPSSMLIPEVVGVKLTGKLPEGVTATDLVLTVTEMLRKKGVVGKFVEFFGEGLASL 295
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  276 SCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTD--IAnLAEEFKDH----LVPDPGCQYDQVIEINLNELKPHI 349
Cdd:PRK09277 296 SLADRATIANMAPEYGATCGFFPIDEETLDYLRLTGRDEeqVA-LVEAYAKAqglwRDPLEEPVYTDVLELDLSTVEPSL 374
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  350 NGP-------FTPDLAH--------PVADVGTVAEKEGWPLDIRVG-----LIGSCTNSS--YEDMGrsAA-VAKQALAH 406
Cdd:PRK09277 375 AGPkrpqdriPLSDVKEafaksaelGVQGFGLDEAEEGEDYELPDGavviaAITSCTNTSnpSVMIA--AGlLAKKAVEK 452
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  407 GLKCKS--QFTITPGSEQIRATIERDGYAQILRDVG-GIVlANACGPCIG---------QwdrKDIKkgEKNTIVT---S 471
Cdd:PRK09277 453 GLKVKPwvKTSLAPGSKVVTDYLEKAGLLPYLEALGfNLV-GYGCTTCIGnsgplppeiE---KAIN--DNDLVVTavlS 526
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  472 YNRNFTGRndANPETHA-FVTSPEIVTALAIAGTLKFNPETDFL-TGKDGKKFKLEA--PDADE---LPRSDFDPGQ--D 542
Cdd:PRK09277 527 GNRNFEGR--IHPLVKAnYLASPPLVVAYALAGTVDIDLEKDPLgTDKDGNPVYLKDiwPSDEEidaVVAKAVKPEMfrK 604
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  543 TYQHPPK-DSSGQRVDVS--------PTSQRLQlLEPFdkWDG--------KDLEDLQILIKVKGKCTTDHIS------- 598
Cdd:PRK09277 605 EYADVFEgDERWNAIEVPegplydwdPDSTYIR-NPPY--FEGmlaepgpvRDIKGARVLALLGDSITTDHISpagaika 681
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  599 --AAGPWLK--------F--------------RGHLDNIS--NNLLIGainIENGKAnsvRNAVTQEFGPVPDTARYYKK 652
Cdd:PRK09277 682 dsPAGKYLLehgvepkdFnsygsrrgnhevmmRGTFANIRirNEMVPG---VEGGYT---RHFPEGEVMSIYDAAMKYKE 755
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  653 HGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYN--KIHPVDKLTIQGLK 730
Cdd:PRK09277 756 EGTPLVVIAGKEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKPGESRKtlGLDGTETFDIEGLE 835
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|....*
gi 18079339  731 DFAPGKPLKCVIKHPNGTQETI-LLNHTFNETQIEWFRAGSALNR 774
Cdd:PRK09277 836 DLKPGATVTVVITRADGEVVEFpVLCRIDTAVEVDYYRNGGILQY 880
PRK00402 PRK00402
3-isopropylmalate dehydratase large subunit; Reviewed
62-503 2.12e-69

3-isopropylmalate dehydratase large subunit; Reviewed


Pssm-ID: 234748  Cd Length: 418  Bit Score: 234.30  E-value: 2.12e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   62 PLTLSEKIVYGHlddpANQEIERGKtYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIH--CDHLIEAqvggeKD 139
Cdd:PRK00402   2 GMTLAEKILARH----SGRDVSPGD-IVEAKVDLVMAHDITGPLAIKEFEKIGGDKVFDPSKIVivFDHFVPA-----KD 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  140 LRRAKdINQEVYNFLATAGAKYgvgFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNggglggicigvggADAV---- 214
Cdd:PRK00402  72 IKSAE-QQKILREFAKEQGIPN---FFDVGEGICHQVLPEKgLVRPGDVVVGADSHTCT-------------YGALgafa 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  215 ------D---VMA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATIC 284
Cdd:PRK00402 135 tgmgstDmaaAMAtGKTW-FKVPETIKVVLEGKLPPGVTAKDVILHIIGDIGVDGATYKALEFTGETIEALSMDERMTLA 213
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  285 NMGAEIGATTSVFPYNHRMKKYLsktgrtdiANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADV 364
Cdd:PRK00402 214 NMAIEAGAKAGIFAPDEKTLEYL--------KERAGRDYKPWKSDEDAEYEEVYEIDLSKLEPQVAAPHLPDNVKPVSEV 285
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  365 gtvaekEGWPLDIRVglIGSCTNSSYEDMGRSAAVAKqalAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVL 444
Cdd:PRK00402 286 ------EGTKVDQVF--IGSCTNGRLEDLRIAAEILK---GRKVAPGVRLIVIPASQKIYLQALKEGLIEIFVDAGAVVS 354
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 18079339  445 ANACGPCIGqwdrkdIKKGEknTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAG 503
Cdd:PRK00402 355 TPTCGPCLGghm-gvLAPGE--VCLSTTNRNFKGRM-GSPESEVYLASPAVAAASAVTG 409
IPMI cd01583
3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and ...
95-503 9.80e-67

3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Aconatase-like catalytic domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes.


Pssm-ID: 153133 [Multi-domain]  Cd Length: 382  Bit Score: 225.92  E-value: 9.80e-67
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  95 RVAMQDATAQMAMLQFISSGLPKVAVPSTIHC--DHLIEAqvggekDLRRAKDINQEVYNFLATAGAK-YGVGfwrpGSG 171
Cdd:cd01583   1 LHLVHDVTSPQAFEGLREAGREKVWDPEKIVAvfDHNVPT------PDIKAAEQVKTLRKFAKEFGINfFDVG----RQG 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 172 IIHQIILENY-AYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVIL 249
Cdd:cd01583  71 ICHVILPEKGlTLPGMTIVGGDSHTCTHGAFGAFATGIGTTDVAHVLAtGKLW-FRVPETMRVNVEGKLPPGVTAKDVIL 149
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 250 KVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRtdianlaEEFKdHLVPD 329
Cdd:cd01583 150 YIIGKIGVDGATYKAMEFAGEAIESLSMEERMTLCNMAIEAGAKAGIVAPDETTFEYLKGRGK-------AYWK-ELKSD 221
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 330 PGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVgtvaekEGWPLDIRVglIGSCTNSSYEDMGRSAAVAKqalAHGLK 409
Cdd:cd01583 222 EDAEYDKVVEIDASELEPQVAWPHSPDNVVPVSEV------EGIKIDQVF--IGSCTNGRLEDLRAAAEILK---GRKVA 290
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 410 CKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG-QWDRkdIKKGEknTIVTSYNRNFTGR-NDANPETH 487
Cdd:cd01583 291 DGVRLIVVPASQRVYKQAEKEGLIEIFIEAGAEVRPPGCGACLGgHMGV--LAPGE--RCVSTSNRNFKGRmGSPGARIY 366
                       410
                ....*....|....*.
gi 18079339 488 afVTSPEIVTALAIAG 503
Cdd:cd01583 367 --LASPATAAASAITG 380
LeuC COG0065
Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] ...
61-505 3.30e-63

Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism];


Pssm-ID: 223143  Cd Length: 423  Bit Score: 217.84  E-value: 3.30e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  61 RPLTLSEKIVYGHLDDPanqEIERGKTYLrLRPDRVAMQDATAQMAMLQFISSGLpKVAVPSTIHC--DHLIEAqvggeK 138
Cdd:COG0065   1 SAKTLYEKILDAHVGKE---EVGAGETVL-LYIDLHLVHDVTSPQAFEGLREAGR-KVRDPEKTVAtfDHNVPT-----P 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 139 DLRRAKDInQEVYNFLATAGAK--YGVGfwrpGSGIIHQIILEN-YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVD 215
Cdd:COG0065  71 DIKAAEQQ-KELRENAKEFGIVnfYDVG----DQGIVHQVGPEQgLTLPGMTIVGGDSHTCTHGAFGAFAFGIGTTDVAH 145
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 216 VMA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATT 294
Cdd:COG0065 146 VLAtGKLW-FRVPKTMKVEVEGKLPPGVTAKDIILALIGKIGVDGGTGYAIEFAGEAIRSLSMEGRMTLCNMAIEAGAKA 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 295 SVFPYNHRMKKYLsktgRTDIAnlAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDlahpvaDVGTVAEKEGWP 374
Cdd:COG0065 225 GIIAPDETTFEYL----KEWDG--AVAYWKTLKSDEDAVYDKVVELDASDLEPQVAWPTNPD------NVVPVSEVEPDP 292
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 375 LDIRVGLIGSCTNSSYEDMGRSAAVAKqalAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGq 454
Cdd:COG0065 293 IKIDQVFIGSCTNGRIEDLRAAAEILK---GRKVAPGVRAIVVPGSRRVKEQAEKEGLDKIFIEAGFEWREPGCGPCLG- 368
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|..
gi 18079339 455 wdRKDIKKGEKNTIVTSYNRNFTGR-NDANPETHafVTSPEIVTALAIAGTL 505
Cdd:COG0065 369 --MHPGVLGPGERCASTSNRNFEGRqGSPGARTY--LASPAMAAAAAVEGEI 416
PTZ00092 PTZ00092
aconitate hydratase-like protein; Provisional
94-709 9.42e-62

aconitate hydratase-like protein; Provisional


Pssm-ID: 240263 [Multi-domain]  Cd Length: 898  Bit Score: 223.74  E-value: 9.42e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   94 DRVAMQDAtaqMAML----QFISsglPKVAVPSTIhcDHLIEAQVGGEKD-LRRAKDI----NQEVYNFLatagaKYGVG 164
Cdd:PTZ00092 106 DLAAMRDA---MKRLggdpAKIN---PLVPVDLVI--DHSVQVDFSRSPDaLELNQEIeferNLERFEFL-----KWGSK 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  165 FWR------PGSGIIHQIILE----------NYAYPGVLlIGTDSHTP--NGGGLGGICIGVGGADAVdvMAGIPWELKC 226
Cdd:PTZ00092 173 AFKnllivpPGSGIVHQVNLEylarvvfnkdGLLYPDSV-VGTDSHTTmiNGLGVLGWGVGGIEAEAV--MLGQPISMVL 249
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  227 PKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY 306
Cdd:PTZ00092 250 PEVVGFKLTGKLSEHVTATDLVLTVTSMLRKRGVVGKFVEFYGPGVKTLSLADRATIANMAPEYGATMGFFPIDEKTLDY 329
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  307 LSKTGRTDIA-NLAEEF--KDHLVPDPGCQ--YDQVIEINLNELKPHINGP---------------FTPDLAHPVA---- 362
Cdd:PTZ00092 330 LKQTGRSEEKvELIEKYlkANGLFRTYAEQieYSDVLELDLSTVVPSVAGPkrphdrvplsdlkkdFTACLSAPVGfkgf 409
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  363 -----DVGTVAEKE--GWPLDIRVG-----LIGSCTNSSYED-MGRSAAVAKQALAHGLKCKS--QFTITPGSEQIRATI 427
Cdd:PTZ00092 410 gipeeKHEKKVKFTykGKEYTLTHGsvviaAITSCTNTSNPSvMLAAGLLAKKAVEKGLKVPPyiKTSLSPGSKVVTKYL 489
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  428 ERDGYAQILRDVGGIVLANACGPCIGqwDRKDIKKGEKNTI---------VTSYNRNFTGRndANPETHA-FVTSPEIVT 497
Cdd:PTZ00092 490 EASGLLKYLEKLGFYTAGYGCMTCIG--NSGDLDPEVSEAItnndlvaaaVLSGNRNFEGR--VHPLTRAnYLASPPLVV 565
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  498 ALAIAGTLKFNPETDFL-TGKDGKKFKLEA--PDADEL--------------------------------PRSDF---DP 539
Cdd:PTZ00092 566 AYALAGRVNIDFETEPLgSDKTGKPVFLRDiwPSREEIqaleakyvkpemfkevysnitqgnkqwnelqvPKGKLyewDE 645
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  540 gQDTYQHPPKDSSGQRVDVSPTsqrlqllepfdkwdgKDLEDLQILIKVKGKCTTDHISAAG------PWLKF------- 606
Cdd:PTZ00092 646 -KSTYIHNPPFFQTMELEPPPI---------------KSIENAYCLLNLGDSITTDHISPAGniaknsPAAKYlmergve 709
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  607 ------------------RGHLDNIS-NNLLIGA-----INIENGKANSVRNAvtqefgpvpdtARYYKKHGIRWVVIGD 662
Cdd:PTZ00092 710 rkdfntygarrgndevmvRGTFANIRlINKLCGKvgpntVHVPTGEKMSIYDA-----------AEKYKQEGVPLIVLAG 778
                        730       740       750       760
                 ....*....|....*....|....*....|....*....|....*..
gi 18079339  663 ENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTF 709
Cdd:PTZ00092 779 KEYGSGSSRDWAAKGPYLQGVKAVIAESFERIHRSNLVGMGILPLQF 825
Aconitase_C pfam00694
Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This ...
582-712 7.95e-61

Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This domain undergoes conformational change in the enzyme mechanism.


Pssm-ID: 395564 [Multi-domain]  Cd Length: 131  Bit Score: 201.05  E-value: 7.95e-61
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   582 LQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIG 661
Cdd:pfam00694   1 MARFLTLKGLTTPDFNSNVDTDLIIPKQFLGTIANIGIGNINFEGWRAGKTTHLPDGENPDFYDAAERYKQHGAPIVVIA 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 18079339   662 DENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADP 712
Cdd:pfam00694  81 GKNYGCGSSREHAAWALRDLGIKAVIAESFARIHRNNLIKNGLLPLEFPRE 131
PLN00070 PLN00070
aconitate hydratase
67-714 1.59e-59

aconitate hydratase


Pssm-ID: 215047 [Multi-domain]  Cd Length: 936  Bit Score: 217.75  E-value: 1.59e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   67 EKIVYGHLDDPANQEIErgktylrLRPDRVAMQDAT--------AQM--AMLQFIS-SGLPKVAVPSTIHCDHLIEAQVG 135
Cdd:PLN00070 103 EKIIDWENTSPKQVEIP-------FKPARVLLQDFTgvpavvdlACMrdAMNNLGGdPNKINPLVPVDLVIDHSVQVDVA 175
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  136 GEKDLRRAK-----DINQEVYNFLatagaKYGVGFWR------PGSGIIHQIILENYA----------YPGVLlIGTDSH 194
Cdd:PLN00070 176 RSENAVQANmelefQRNKERFAFL-----KWGSTAFQnmlvvpPGSGIVHQVNLEYLGrvvfntdgilYPDSV-VGTDSH 249
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  195 TPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDS 274
Cdd:PLN00070 250 TTMIDGLGVAGWGVGGIEAEAAMLGQPMSMVLPGVVGFKLSGKLRDGVTATDLVLTVTQMLRKHGVVGKFVEFYGEGMSE 329
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  275 ISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTD----------IANlaEEFKDHLVPDPGCQYDQVIEINLNE 344
Cdd:PLN00070 330 LSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDetvamieaylRAN--KMFVDYNEPQQERVYSSYLELDLED 407
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  345 LKPHINGPFTPD---------------LAHPVADVGTVAEKE-----------GWPLDIRVG-----LIGSCTNSSYED- 392
Cdd:PLN00070 408 VEPCISGPKRPHdrvplkemkadwhscLDNKVGFKGFAVPKEaqskvakfsfhGQPAELRHGsvviaAITSCTNTSNPSv 487
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  393 MGRSAAVAKQALAHGLKCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGqwDRKDIKKGEKNTI-- 468
Cdd:PLN00070 488 MLGAGLVAKKACELGLEVKPwiKTSLAPGSGVVTKYLLKSGLQKYLNQQGFHIVGYGCTTCIG--NSGELDESVASAIte 565
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  469 -------VTSYNRNFTGRndANPETHA-FVTSPEIVTALAIAGTLKFNPETDFL-TGKDGKK--FKLEAPDADE------ 531
Cdd:PLN00070 566 ndivaaaVLSGNRNFEGR--VHPLTRAnYLASPPLVVAYALAGTVDIDFEKEPIgTGKDGKDvfFRDIWPSNEEvaevvq 643
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  532 ---LPrsdfDPGQDTYQHPPKDS---------SGQRVDVSPTSQRLQllEP-------FDKWDGKDLEDLQILIKVKGKC 592
Cdd:PLN00070 644 ssvLP----DMFKSTYEAITKGNpmwnqlsvpSGTLYSWDPKSTYIH--EPpyfknmtMSPPGPHGVKDAYCLLNFGDSI 717
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  593 TTDHISAAG------PWLKF-------------------------RGHLDNIS--NNLLIG-----AINIENGKANSVRn 634
Cdd:PLN00070 718 TTDHISPAGsihkdsPAAKYlmergvdrkdfnsygsrrgndeimaRGTFANIRivNKLLKGevgpkTVHIPTGEKLSVF- 796
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  635 avtqefgpvpDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSD 714
Cdd:PLN00070 797 ----------DAAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGED 866
AcnA_IRP cd01586
Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA ...
95-504 4.66e-46

Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes.


Pssm-ID: 153136  Cd Length: 404  Bit Score: 169.79  E-value: 4.66e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  95 RVAMQDATAQMAMLQFIS--------SGLP-KV--AVPSTIHCDHLIEAQVGG-----EKDLRRAKDINQEVYNFLATAG 158
Cdd:cd01586   1 RVILQDFTGVPAVVDLAAmrdavkrlGGDPeKInpLIPVDLVIDHSVQVDFYGtadalAKNMKLEFERNRERYEFLKWGQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 159 AKYG-VGFWRPGSGIIHQIILE--------------NYAYPGVLlIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWE 223
Cdd:cd01586  81 KAFKnLRVVPPGTGIIHQVNLEylarvvftseedgdGVAYPDSV-VGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQPIS 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 224 LKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNhrm 303
Cdd:cd01586 160 MLLPEVVGVKLTGKLRPGVTATDLVLTVTQMLRKVGVVGKFVEFFGPGVAKLSVADRATIANMAPEYGATCGFFPVD--- 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 304 kkylsktgrtdianlaeefkdhlvpdpgcqyDQVIEINLNELKPHINGPFTPDLAHPVadvgtvaekEGwplDIRVGLIG 383
Cdd:cd01586 237 -------------------------------TQVVELDLSTVEPSVSGPKRPQDRVPL---------HG---SVVIAAIT 273
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 384 SCTNSSYED-MGRSAAVAKQALAHGLKCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG------Q 454
Cdd:cd01586 274 SCTNTSNPSvMLAAGLLAKKAVELGLKVKPyvKTSLAPGSRVVTKYLEASGLLPYLEKLGFHVVGYGCTTCIGnsgplpE 353
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|..
gi 18079339 455 WDRKDIKKGE-KNTIVTSYNRNFTGRndANPETHA-FVTSPEIVTALAIAGT 504
Cdd:cd01586 354 EVEEAIKENDlVVAAVLSGNRNFEGR--IHPLVRAnYLASPPLVVAYALAGT 403
h_aconitase TIGR00139
homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is ...
62-707 1.03e-44

homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 129245 [Multi-domain]  Cd Length: 712  Bit Score: 171.76  E-value: 1.03e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339    62 PLTLSEKIVYGH-LDDPANQEIERGKtYLRLRPDRVAMQDATAQMAmLQFISSGLPKVAVPSTI--HCDHliEAQVGGEK 138
Cdd:TIGR00139   1 GQNLTEKIVQKYaVGLPEGKFVHSGD-YVSIKPAHCMSHDNSWPCA-LKFMGIGASKIHNPDQIvmTLDH--DIQNKSDK 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   139 DLRRAKDINqevyNFlataGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVM 217
Cdd:TIGR00139  77 NLKKYKNIE----EF----AKKHGIDFYPAGRGIGHQIMIEEgFAFPGNLAVASDSHSNMYGGLGCLGTPIVRTDAAAIW 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   218 A-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPG--VDSISCTGMATICNMGAEIGATT 294
Cdd:TIGR00139 149 AtGKTW-WQIPPVAKVEFKGQLPPGVSGKDIIVALCGLFNKDDVLNHAIEFTGSEdsLNALPIDHRLTIANMTTEWGALS 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   295 SVFPYNHRMKKYLS------------------KTGRTDIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPD 356
Cdd:TIGR00139 228 GLFPIDKTLIDWLKgkatlaalgladgpfinpAAERFTHPALEEKAEIPLKADKDAHYAKELFIDLASLSHYVSGPNSVK 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   357 LAHPVADVgtvaekEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQA----------LAHGLKcksqFTITPGSEQIRAT 426
Cdd:TIGR00139 308 VANPLKDL------EAQDIKIDKAYLVSCTNSRASDIAAAADVFCEAadknggkinkIAPGVE----FYIAAASIEEEAA 377
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   427 IERDGYAQILRDVGGIVLANACGPCIGQwDRKDIKKGEKNtiVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLK 506
Cdd:TIGR00139 378 AEGNGAWEKLLEAGAIPLPAGCGPCIGL-GAGLLEPGEVG--ISASNRNFKGRM-GSKDAKAYLASPAVVAASALLGKIS 453
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   507 fnpetdfltgkdGKKFKLEAPDADELPRSDFD-----PGQDTYQHPPKDSSGQRVD-VSPTSQRLQLLEPfdKWDGKDLE 580
Cdd:TIGR00139 454 ------------GPAEVLSPEGWTEIIFGEGDgikeeDRMLTNEEALEKIIGIIDDlVADEEKNAASEAP--AQEESEQG 519
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   581 DLQILI----KVKGK---CTTDHISAAGPWLKFRGHLDNISNNLLiGAINIENGKAnsvrnavtqEFgpvpdtaRYYKKH 653
Cdd:TIGR00139 520 LTEILEgfpeEFSGElvfCDADNINTDGIYPGKYTYQDDVPKEKM-AQVCMENYDA---------EF-------RTKAHE 582
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|....
gi 18079339   654 GIrwVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPL 707
Cdd:TIGR00139 583 GD--ILVSGFNFGCGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNALLGL 634
Homoaconitase cd01582
Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase ...
108-505 1.89e-36

Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase catalytic domain. Homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases.


Pssm-ID: 153132  Cd Length: 363  Bit Score: 141.21  E-value: 1.89e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 108 LQFISSGLPKVAVPSTIHC--DHliEAQVGGEKDLRRAKDINqevyNFlataGAKYGVGFWRPGSGIIHQIILEN-YAYP 184
Cdd:cd01582  13 LKFMSIGATKIHNPDQIVMtlDH--DVQNKSEKNLKKYKNIE----SF----AKKHGIDFYPAGRGIGHQIMIEEgYAFP 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 185 GVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGA 263
Cdd:cd01582  83 GTLAVASDSHSNMYGGVGCLGTPIVRTDAAAIWAtGQTW-WQIPPVAKVELKGQLPKGVTGKDVIVALCGLFNKDQVLNH 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 264 IVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRmkkylsktgrtdianlaeefkdHLVpdpgcqydqvieINLN 343
Cdd:cd01582 162 AIEFTGSGLNSLSVDTRLTIANMTTEWGALSGLFPTDAK----------------------HLI------------LDLS 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 344 ELKPHINGPFTPDLAHPVADVgtvaekEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQA--------LAHGLKcksqFT 415
Cdd:cd01582 208 TLSPYVSGPNSVKVSTPLKEL------EAQNIKINKAYLVSCTNSRASDIAAAADVVKGKkekngkipVAPGVE----FY 277
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 416 ITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGqWDRKDIKKGEKNtiVTSYNRNFTGRNdANPETHAFVTSPEI 495
Cdd:cd01582 278 VAAASSEVQAAAEKNGDWQTLLEAGATPLPAGCGPCIG-LGQGLLEPGEVG--ISATNRNFKGRM-GSTEALAYLASPAV 353
                       410
                ....*....|
gi 18079339 496 VTALAIAGTL 505
Cdd:cd01582 354 VAASAISGKI 363
PRK05478 PRK05478
3-isopropylmalate dehydratase large subunit;
227-505 3.08e-31

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 235490  Cd Length: 466  Bit Score: 127.93  E-value: 3.08e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  227 PKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGA---------TTsvF 297
Cdd:PRK05478 163 PKTMKIEVDGKLPPGVTAKDIILAIIGKIGTAGGTGYVIEFAGEAIRALSMEGRMTICNMSIEAGAraglvapdeTT--F 240
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  298 PYnhrMKkylsktGRtDIANLAEEFK------DHLVPDPGCQYDQVIEINLNELKPH------------INGPF-TPDLA 358
Cdd:PRK05478 241 EY---LK------GR-PFAPKGEDWDkavaywKTLKSDEDAVFDKVVTLDAADIEPQvtwgtnpgqvisIDGKVpDPEDF 310
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  359 HPVADVGTVAE-------KEGWPL-DIRVG--LIGSCTNSSYEDMGRSAAVAKqalahGLKCKSQFT--ITPGSEQIRAT 426
Cdd:PRK05478 311 ADPVKRASAERalaymglKPGTPItDIKIDkvFIGSCTNSRIEDLRAAAAVVK-----GRKVAPGVRalVVPGSGLVKAQ 385
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  427 IERDGYAQILRDVG------GivlanaCGPCIGQWDrkDIKKGEKNTIVTSyNRNFTGRNDANPETHafVTSPEIVTALA 500
Cdd:PRK05478 386 AEAEGLDKIFIEAGfewrepG------CSMCLAMNP--DKLPPGERCASTS-NRNFEGRQGKGGRTH--LVSPAMAAAAA 454

                 ....*
gi 18079339  501 IAGTL 505
Cdd:PRK05478 455 ITGHF 459
Aconitase_swivel cd00404
Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible ...
587-728 6.26e-30

Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. The aconitase family contains the following proteins: - Iron-responsive element binding protein (IRE-BP). IRE-BP is a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 238236 [Multi-domain]  Cd Length: 88  Bit Score: 113.33  E-value: 6.26e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 587 KVKGKCTTDHISAAGPWlkfrghldnisnnlligainiengkansvrnavtqefgpvpdtaryykkhgirwVVIGDENYG 666
Cdd:cd00404   1 KVAGNITTDHISPAGPG------------------------------------------------------VVIGDENYG 26
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 18079339 667 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQG 728
Cdd:cd00404  27 TGSSREHAALELRLLGGRAVIAKSFARIFFRNLVDQGLLPLEFADPEDYLKLHTGDELDIYP 88
PRK12466 PRK12466
3-isopropylmalate dehydratase large subunit;
60-505 2.29e-28

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 183543  Cd Length: 471  Bit Score: 119.24  E-value: 2.29e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   60 NRPLTLSEKIVYGH----LDDpanqeierGKTYLRLrpDRVAMQDATAQMAMLQFISSGLPkVAVPSTIHC--DHLIEAQ 133
Cdd:PRK12466   1 MMPRTLYDKLWDSHtvarLDD--------GHVLLYI--DRHLLNEYTSPQAFSGLRARGRT-VRRPDLTLAvvDHVVPTR 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  134 VGGEKDLRRAKDINQEVYnfLATAGAKYGVGFWR---PGSGIIHQIILE-NYAYPGVLLIGTDSHTPNGGGLGGICIGVG 209
Cdd:PRK12466  70 PGRDRGITDPGGALQVDY--LRENCADFGIRLFDvddPRQGIVHVVAPElGLTLPGMVIVCGDSHTTTYGALGALAFGIG 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  210 GADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAE 289
Cdd:PRK12466 148 TSEVEHVLATQTLVYRKPKTMRVRVDGELPPGVTAKDLILALIARIGADGATGYAIEFAGEAIRALSMEGRMTLCNMAVE 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  290 IGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDH---LVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPV----- 361
Cdd:PRK12466 228 AGARGGLIAPDETTFDYLRGRPRAPKGALWDAALAYwrtLRSDADAVFDREVEIDAADIAPQVTWGTSPDQAVPItgrvp 307
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  362 --ADVGTVAEKE-------------GWPL-DIRVG--LIGSCTNSSYEDMGRSAAVAKqalahGLKCKSQFT--ITPGSE 421
Cdd:PRK12466 308 dpAAEADPARRAameraldymgltpGTPLaGIPIDrvFIGSCTNGRIEDLRAAAAVLR-----GRKVAPGVRamVVPGSG 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  422 QIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKdIKKGEKntIVTSYNRNFTGRNDANPETHafVTSPEIVTALAI 501
Cdd:PRK12466 383 AVRRQAEAEGLARIFIAAGFEWREPGCSMCLAMNDDV-LAPGER--CASTTNRNFEGRQGPGARTH--LMSPAMVAAAAV 457

                 ....
gi 18079339  502 AGTL 505
Cdd:PRK12466 458 AGHI 461
AcnA_Bact_Swivel cd01579
Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) ...
587-728 2.54e-28

Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism. This distinct subfamily is found only in bacteria and archea. Its exact characteristics are not known.


Pssm-ID: 238811 [Multi-domain]  Cd Length: 121  Bit Score: 109.83  E-value: 2.54e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 587 KVKGKCTTDHISAAGP-WLKFRGHLDNISNNLLIGainiengkansvrnaVTQEFGPvpdtaryYKKHGIRWVVIGDENY 665
Cdd:cd01579   1 KVGDNITTDHIMPAGAkVLPLRSNIPAISEFVFHR---------------VDPTFAE-------RAKAAGPGFIVGGENY 58
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 18079339 666 GEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQG 728
Cdd:cd01579  59 GQGSSREHAALAPMYLGVRAVLAKSFARIHRANLINFGILPLTFADEDDYDRFEQGDQLELPL 121
PRK11413 PRK11413
putative hydratase; Provisional
89-731 3.06e-24

putative hydratase; Provisional


Pssm-ID: 183125 [Multi-domain]  Cd Length: 751  Bit Score: 108.56  E-value: 3.06e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339   89 LRLRPDRVAMQDAT----AQMAmlqfISSGLPKVAVPSTIHCDHLIEAQVGGEkdlrrakdINQEVYNFLATAGAKYGVG 164
Cdd:PRK11413  54 LKIKFDSLASHDITfvgiIQTA----KASGMERFPLPYVLTNCHNSLCAVGGT--------INEDDHVFGLSAAQKYGGI 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  165 FWRPGSGIIHQIILENYAYPGVLLIGTDSHTpnggglggicigvgGADAVDVMA---GIP----------WELKCPKVIG 231
Cdd:PRK11413 122 FVPPHIAVIHQYMREMMAGGGKMILGSDSHT--------------RYGALGTMAvgeGGGelvkqllndtYDIDYPGVVA 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  232 VKLTGSLSGWTSPKDVILKVAGILTVKGGT-GAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKT 310
Cdd:PRK11413 188 VYLTGKPAPGVGPQDVALAIIGAVFKNGYVkNKVMEFVGPGVSALSTDFRNGVDVMTTETTCLSSIWQTDEEVHNWLALH 267
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  311 GRtdianlAEEFKDhLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVA-------DVGTVAEKEGWPLD------- 376
Cdd:PRK11413 268 GR------GQDYCE-LNPQPMAYYDGCISVDLSAIKPMIALPFHPSNVYEIDelnqnltDILREVEIESERVAhgkakls 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  377 ---------IRV--GLIGSCTNSSYEDMgrsaavakQALAHGLKCKS----QFTIT--PGSEQIRATIERDGYAQILRDV 439
Cdd:PRK11413 341 lldkiengrLKVqqGIIAGCSGGNYENV--------IAAANALRGQScgndTFSLSvyPSSQPVFMDLAKKGVVADLMGA 412
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  440 GGIVLANACGPCIGQWDrkdikkgekntivTSYN---------RNFTGRNDANPeTHAFVTSPEIVTALAIAGTLKFNpe 510
Cdd:PRK11413 413 GAIIRTAFCGPCFGAGD-------------TPANnglsirhttRNFPNREGSKP-ANGQMSAVALMDARSIAATAANG-- 476
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  511 tDFLTGKDgkkfklEAPDADELPRSDFDPgqDTYQHPPKDSSGQRVdvspTSQRLQLLEPFDKWdgKDLEDL--QILIKV 588
Cdd:PRK11413 477 -GYLTSAT------ELDCWDNVPEYAFDV--TPYKNRVYQGFGKGA----TQQPLIYGPNIKDW--PEMGALtdNILLKV 541
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  589 KGK-----CTTDHISAAGPWLKFRghldniSNNLLIGAIN--------IENGKA-----NSVRNAVTQEFGPVPDTAR-Y 649
Cdd:PRK11413 542 CSKildpvTTTDELIPSGETSSYR------SNPLGLAEFTlsrrdpgyVGRSKAvaeleNQRLAGNVSELTEVFARIKqI 615
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  650 YKKHGIRW--VVIGDENY----GEGSSREHAALEPRHLGGRAIITKSFA-RIHETNLKKQGLLPLTFADPSDynkIHPVD 722
Cdd:PRK11413 616 AGQEHIDPlqTEIGSMVYavkpGDGSAREQAASCQRVLGGLANIAEEYAtKRYRSNVINWGMLPFQMAEEPT---FEVGD 692

                 ....*....
gi 18079339  723 KLTIQGLKD 731
Cdd:PRK11413 693 YIYIPGIRA 701
AcnA_IRP_Swivel cd01580
Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, ...
593-712 1.41e-18

Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238812 [Multi-domain]  Cd Length: 171  Bit Score: 83.86  E-value: 1.41e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 593 TTDHISAAGPWLK-------------------------------FRGHLDNISN-NLLIGainieNGKANSVRNAVTQEF 640
Cdd:cd01580   7 TTDHISPAGSIAKdspagkylaergvkprdfnsygsrrgndevmMRGTFANIRLrNKLVP-----GTEGGTTHHPPTGEV 81
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 18079339 641 GPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADP 712
Cdd:cd01580  82 MSIYDAAMRYKEEGVPLVILAGKEYGSGSSRDWAAKGPFLLGVKAVIAESFERIHRSNLVGMGILPLQFPPG 153
IPMI_Swivel cd01577
Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized ...
658-726 1.26e-13

Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238809 [Multi-domain]  Cd Length: 91  Bit Score: 66.84  E-value: 1.26e-13
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADP-SDYNKIHPVDKLTI 726
Cdd:cd01577  20 IIVAGKNFGCGSSREHAPWALKDAGIRAVIAESFARIFFRNAINNGLLPVTLADEdVEEVEAKPGDEVEV 89
AcnB cd01581
Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA ...
65-505 1.31e-12

Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle; Aconitase B catalytic domain. Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase has an active (4FE-4S) and an inactive (3FE-4S) form. The active cluster is part of the catalytic site that interconverts citrate, cis-aconitase and isocitrate. The domain architecture of aconitase B is different from other aconitases in that the catalytic domain is normally found at C-terminus for other aconitases, but it is at N-terminus for B family. It also has a HEAT domain before domain 4 which plays a role in protein-protein interaction. This alignment is the core domain including domains 1,2 and 3.


Pssm-ID: 153131  Cd Length: 436  Bit Score: 70.61  E-value: 1.31e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  65 LSEKIVyGHldDPANQEIERGkTYLRLRPDRVAMQDATAQM--------AMLQFISSGlpkvAVPSTIHcdhliEAQVGG 136
Cdd:cd01581   1 LAQKIV-GR--ACGVKGVRPG-TYCEPKMTTVGSQDTTGPMtrdelkelACLGFSADL----VMQSFCH-----TAAYPK 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 137 EKDLRRAKDINQEVYNFlatagakyGVGFWRPGSGIIHQIiLENYAYPGVLLIGTDSHT--PNGGGLGGICIGVGGADAV 214
Cdd:cd01581  68 PVDVKTHRTLPDFISNR--------GGVALRPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFAAAT 138
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 215 DVMAgipweLKCPKVIGVKLTGSLSGWTSPKDVILKV------AGILTV--KGG----TGAIVEYHGpgVDSISCTGMAT 282
Cdd:cd01581 139 GVMP-----LDMPESVLVRFKGKMQPGITLRDLVNAIpyyaiqQGLLTVekKGKknvfNGRILEIEG--LPDLKVEQAFE 211
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 283 ICNMGAEIGATTSVFPYNH------------RMKKYLSKtGRTDIANLAEEFKDH---------LVPDPGCQYDQVIEIN 341
Cdd:cd01581 212 LTDASAERSAAACTVRLDKepvieylesnvvLMKIMIAN-GYDDARTLLRRIIAMeewlanpplLEPDADAEYAAVIEID 290
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 342 LNELK-PHINGPFTPDlahpvaDVGTVAEKEGWPLDIrvGLIGSC-TNssyedMGRSAAVAKQALAHGLKcKSQFTITPG 419
Cdd:cd01581 291 LDDIKePILACPNDPD------DVKLLSEVAGKKIDE--VFIGSCmTN-----IGHFRAAAKILRGKEFK-PTRLWVAPP 356
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 420 SEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGR--NDANpethAFVTSPEIVT 497
Cdd:cd01581 357 TRMDWAILQEEGYYSIFGDAGARTEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFDNRvgKGAE----VYLGSAELAA 428

                ....*...
gi 18079339 498 ALAIAGTL 505
Cdd:cd01581 429 VCALLGRI 436
AcnB COG1049
Aconitase B [Energy production and conversion];
152-505 3.39e-12

Aconitase B [Energy production and conversion];


Pssm-ID: 223978 [Multi-domain]  Cd Length: 852  Bit Score: 70.16  E-value: 3.39e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 152 NFLATAGakyGVGFwRPGSGIIHQIiLENYAYPGVLLIGTDSHT--PNGGGLGGICIGVGGADAVDVMAgipweLKCPKV 229
Cdd:COG1049 453 DFIMNRG---GVSL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFAAATGVMP-----LDMPES 522
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 230 IGVKLTGSLSGWTSPKDVILKVA------GILTVKGG------TGAIVEYHGPG---VD--------SISCTGMATICNM 286
Cdd:COG1049 523 VLVRFKGEMQPGITLRDLVHAIPyyaikqGLLTVEKKgkknifSGRILEIEGLPdlkVEqafeltdaSAERSAAGCTIKL 602
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 287 GAEigattSVFPY---NHRMKKYLSKTGRTDIANL------AEEFKDH---LVPDPGCQYDQVIEINLNELK-PHINGPF 353
Cdd:COG1049 603 NKE-----PIIEYlksNIVLLKWMIAEGYGDARTLerridkMEAWLANpelLEADADAEYAAVIEIDLADIKePILAAPN 677
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339 354 TPDlahpvaDVGTVAEKEGWPLDIrvGLIGSC-TNssyedMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGY 432
Cdd:COG1049 678 DPD------DVRLLSEVAGDKIDE--VFIGSCmTN-----IGHFRAAGKLLENAKGELPTRLWVAPPTKMDAAQLTEEGY 744
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18079339 433 AQILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGR--NDANpethAFVTSPEIVTALAIAGTL 505
Cdd:COG1049 745 YSIFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKGAN----VYLASAELAAVCAILGKI 811
LeuD COG0066
3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];
658-711 4.86e-11

3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];


Pssm-ID: 223144 [Multi-domain]  Cd Length: 191  Bit Score: 62.61  E-value: 4.86e-11
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....
gi 18079339 658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFAD 711
Cdd:COG0066  65 ILVAGENFGCGSSREHAPWALKDYGIRAVIAPSFADIFYRNAINNGLLPIVLAE 118
PLN00094 PLN00094
aconitate hydratase 2; Provisional
152-505 7.06e-11

aconitate hydratase 2; Provisional


Pssm-ID: 215053 [Multi-domain]  Cd Length: 938  Bit Score: 65.71  E-value: 7.06e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  152 NFLATAGakyGVGFwRPGSGIIHQIiLENYAYPGVLLIGTDSHT--PNGGGLGGICIGVGGADAVDVMAgipweLKCPKV 229
Cdd:PLN00094 525 DFIRNRG---GVSL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFGAATGVIP-----LDMPES 594
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  230 IGVKLTGSLSGWTSPKDVILKV------AGILTV-KGG-----TGAIVEYHGpgVDSISCTGMATICNMGAEIGAT---- 293
Cdd:PLN00094 595 VLVRFTGTMQPGITLRDLVHAIpytaiqDGLLTVeKKGkknvfSGRILEIEG--LPHLKCEQAFELSDASAERSAAgcti 672
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  294 ----TSVFPY---NHRMKKYLSKTGRTD-------IANLAEEFKD-HLV-PDPGCQYDQVIEINLNELK-PHINGPFTPD 356
Cdd:PLN00094 673 kldkEPIIEYlnsNVVMLKWMIAEGYGDrrtlerrIARMQQWLADpELLeADPDAEYAAVIEIDMDEIKePILCAPNDPD 752
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  357 lahpvaDVGTVAEKEGWPLDiRVgLIGSC-TNssyedMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQI 435
Cdd:PLN00094 753 ------DARLLSEVTGDKID-EV-FIGSCmTN-----IGHFRAAGKLLNDNLSQLPTRLWVAPPTKMDEAQLKAEGYYST 819
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 18079339  436 LRDVGGIVLANACGPCIGQWDRkdikKGEKNTIVTSYNRNFTGR--NDANpethAFVTSPEIVTALAIAGTL 505
Cdd:PLN00094 820 FGTVGARTEMPGCSLCMGNQAR----VAEKSTVVSTSTRNFPNRlgKGAN----VYLASAELAAVAAILGRL 883
leuD PRK00439
3-isopropylmalate dehydratase small subunit; Reviewed
658-726 3.74e-09

3-isopropylmalate dehydratase small subunit; Reviewed


Pssm-ID: 234762 [Multi-domain]  Cd Length: 163  Bit Score: 56.37  E-value: 3.74e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 18079339  658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDynKIHPVDKLTI 726
Cdd:PRK00439  51 IIVAGKNFGCGSSREHAPIALKAAGVSAVIAKSFARIFYRNAINIGLPVLECDEAVD--KIEDGDEVEV 117
PRK14023 PRK14023
homoaconitate hydratase small subunit; Provisional
644-714 1.05e-08

homoaconitate hydratase small subunit; Provisional


Pssm-ID: 184460 [Multi-domain]  Cd Length: 166  Bit Score: 55.19  E-value: 1.05e-08
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 18079339  644 PDTARYYKKHGIrwvVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSD 714
Cdd:PRK14023  41 PEFASTVRPGDI---LVAGRNFGLGSSREYAPEALKMLGIGAIIAKSYARIFYRNLVNLGIPPFESEEVVD 108
PRK09238 PRK09238
bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated
326-505 3.78e-08

bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated


Pssm-ID: 236424 [Multi-domain]  Cd Length: 835  Bit Score: 57.11  E-value: 3.78e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  326 LVPDPGCQYDQVIEINLNELK-PHINGPFTPDLAHPVADVGtvAEKegwpldIRVGLIGSC-TNssyedMGRSAAVAKQA 403
Cdd:PRK09238 647 LEADADAEYAAVIEIDLAEIKePILACPNDPDDVRLLSEVA--GTK------IDEVFIGSCmTN-----IGHFRAAGKLL 713
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18079339  404 LAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGR--ND 481
Cdd:PRK09238 714 EGKKGQLPTRLWVAPPTKMDADQLTEEGYYSIFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKG 789
                        170       180
                 ....*....|....*....|....
gi 18079339  482 ANpethAFVTSPEIVTALAIAGTL 505
Cdd:PRK09238 790 AN----VYLGSAELAAVCALLGRI 809
LEUD_arch TIGR02087
3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the ...
658-707 5.28e-08

3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the 3-isopropylmalate dehydratase, small subunits which form TIGR00171. This subfamily includes the members of TIGR02084 which are gene clustered with other genes of leucine biosynthesis. The rest of the subfamily includes mainly archaeal species which exhibit two hits to this model. In these cases it is possible that one or the other of the hits does not have a 3-isopropylmalate dehydratase activity but rather one of the other related aconitase-like activities.


Pssm-ID: 273961 [Multi-domain]  Cd Length: 154  Bit Score: 52.81  E-value: 5.28e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 18079339   658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPL 707
Cdd:TIGR02087  50 VIVAGKNFGCGSSREQAALALKAAGIAAVIAESFARIFYRNAINIGLPLI 99
leuD PRK01641
3-isopropylmalate dehydratase small subunit;
658-726 4.91e-07

3-isopropylmalate dehydratase small subunit;


Pssm-ID: 179314 [Multi-domain]  Cd Length: 200  Bit Score: 50.90  E-value: 4.91e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 18079339  658 VVIGDENYGEGSSREHA--ALEprHLGGRAIITKSFARIHETNLKKQGLLPLTfADPSDYNKI------HPVDKLTI 726
Cdd:PRK01641  70 ILLAGDNFGCGSSREHApwALA--DYGFRAVIAPSFADIFYNNCFKNGLLPIV-LPEEDVDELfklveaNPGAELTV 143
PLN00072 PLN00072
3-isopropylmalate isomerase/dehydratase small subunit; Provisional
658-694 2.03e-05

3-isopropylmalate isomerase/dehydratase small subunit; Provisional


Pssm-ID: 177701 [Multi-domain]  Cd Length: 246  Bit Score: 46.78  E-value: 2.03e-05
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 18079339  658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARI 694
Cdd:PLN00072 132 IIIGGENFGCGSSREHAPVALGAAGAKAVVAESYARI 168
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH