NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|20070408|ref|NP_613061|]
View 

glycine dehydrogenase (decarboxylating), mitochondrial precursor [Mus musculus]

Protein Classification

glycine dehydrogenase (domain architecture ID 11480797)

decarboxylating glycine dehydrogenase catalyzes the degradation of glycine as part of the glycine cleavage system

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK05367 PRK05367
aminomethyl-transferring glycine dehydrogenase;
62-1014 0e+00

aminomethyl-transferring glycine dehydrogenase;


:

Pssm-ID: 235432 [Multi-domain]  Cd Length: 954  Bit Score: 1740.77  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    62 LPRHDDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGM 141
Cdd:PRK05367    4 LENSDAFARRHIGPSAADQQAMLAALGADSLDALIDQAVPASIRLAEPLDLPAALSEAEALAELRAIASKNKVFRSYIGQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   142 GYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKR 221
Cdd:PRK05367   84 GYYGTHTPPVILRNILENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGLEIANASLLDEATAAAEAMALAKRVSKS 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   222 K--KFFVDPRCHPQTIAVVQTRAKYRGVlvELKL-PHEMDFSGKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCA 298
Cdd:PRK05367  164 KsnRFFVDDDVHPQTLDVLRTRAEPLGI--EVVVgDAAKALDHDDVFGVLLQYPGTSGEVRDYTALIAAAHARGALVAVA 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   299 TDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIR 378
Cdd:PRK05367  242 ADLLALTLLTPPGEMGADIAVGSAQRFGVPMGFGGPHAAYFAVRDAYKRSMPGRIVGVSVDAAGNPALRLALQTREQHIR 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   379 RDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCGCSVKEVLGRA 458
Cdd:PRK05367  322 REKATSNICTAQVLLAVMASMYAVYHGPEGLKAIARRVHRLAAILAAGLRALGLEVVHDSFFDTLTVEVGGDAAAVLARA 401
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   459 AQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGC-ESSAELVAEGMGEERRGLLGSSFKRTSPFLTHQVFNSYHSET 537
Cdd:PRK05367  402 LAAGINLRRVDDDHVGISLDETTTREDLAALLAVFGGaALDVDALDADVADASASALPAALLRTSAYLTHPVFNRYHSET 481
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   538 NLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVS 617
Cdd:PRK05367  482 EMMRYLRRLEDKDLALDRSMIPLGSCTMKLNAAAEMIPITWPEFANLHPFAPAEQAAGYRELIDQLEAWLAEITGYDAVS 561
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   618 FQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENL 697
Cdd:PRK05367  562 LQPNAGAQGEYAGLLAIRAYHESRGEGHRDVCLIPSSAHGTNPASAVMAGMKVVVVACDENGNIDLDDLRAKAEEHADNL 641
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   698 AAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIphggggpgmgpigV 777
Cdd:PRK05367  642 AAIMITYPSTHGVFEETIREICEIVHEHGGQVYLDGANMNAQVGLARPGDIGADVSHLNLHKTFCIphggggpgvgpigV 721
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   778 KKHLSPFLPSHPVISIKPTEGtwpVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLF 857
Cdd:PRK05367  722 KAHLAPFLPGHPVQIAGGETG---IGAVSAAPFGSASILPISWMYIRMMGAEGLRQATEVAILNANYIAKRLKDHYPVLY 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   858 RGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAD 937
Cdd:PRK05367  799 TGANGRVAHECILDLRPLKESTGITVDDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKAELDRFCDAMIAIRAEIDE 878
                         890       900       910       920       930       940       950
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 20070408   938 IEEGRIDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKpENKFWPTIARIDDIYGDQHLVCTCPPMEVYE 1014
Cdd:PRK05367  879 VEAGEWPAEDNPLKNAPHTAADLVADEWDHPYSREQAAFPLPSLR-ANKYWPPVGRIDNVYGDRNLVCSCPPIEAYA 954
 
Name Accession Description Interval E-value
PRK05367 PRK05367
aminomethyl-transferring glycine dehydrogenase;
62-1014 0e+00

aminomethyl-transferring glycine dehydrogenase;


Pssm-ID: 235432 [Multi-domain]  Cd Length: 954  Bit Score: 1740.77  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    62 LPRHDDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGM 141
Cdd:PRK05367    4 LENSDAFARRHIGPSAADQQAMLAALGADSLDALIDQAVPASIRLAEPLDLPAALSEAEALAELRAIASKNKVFRSYIGQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   142 GYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKR 221
Cdd:PRK05367   84 GYYGTHTPPVILRNILENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGLEIANASLLDEATAAAEAMALAKRVSKS 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   222 K--KFFVDPRCHPQTIAVVQTRAKYRGVlvELKL-PHEMDFSGKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCA 298
Cdd:PRK05367  164 KsnRFFVDDDVHPQTLDVLRTRAEPLGI--EVVVgDAAKALDHDDVFGVLLQYPGTSGEVRDYTALIAAAHARGALVAVA 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   299 TDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIR 378
Cdd:PRK05367  242 ADLLALTLLTPPGEMGADIAVGSAQRFGVPMGFGGPHAAYFAVRDAYKRSMPGRIVGVSVDAAGNPALRLALQTREQHIR 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   379 RDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCGCSVKEVLGRA 458
Cdd:PRK05367  322 REKATSNICTAQVLLAVMASMYAVYHGPEGLKAIARRVHRLAAILAAGLRALGLEVVHDSFFDTLTVEVGGDAAAVLARA 401
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   459 AQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGC-ESSAELVAEGMGEERRGLLGSSFKRTSPFLTHQVFNSYHSET 537
Cdd:PRK05367  402 LAAGINLRRVDDDHVGISLDETTTREDLAALLAVFGGaALDVDALDADVADASASALPAALLRTSAYLTHPVFNRYHSET 481
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   538 NLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVS 617
Cdd:PRK05367  482 EMMRYLRRLEDKDLALDRSMIPLGSCTMKLNAAAEMIPITWPEFANLHPFAPAEQAAGYRELIDQLEAWLAEITGYDAVS 561
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   618 FQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENL 697
Cdd:PRK05367  562 LQPNAGAQGEYAGLLAIRAYHESRGEGHRDVCLIPSSAHGTNPASAVMAGMKVVVVACDENGNIDLDDLRAKAEEHADNL 641
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   698 AAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIphggggpgmgpigV 777
Cdd:PRK05367  642 AAIMITYPSTHGVFEETIREICEIVHEHGGQVYLDGANMNAQVGLARPGDIGADVSHLNLHKTFCIphggggpgvgpigV 721
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   778 KKHLSPFLPSHPVISIKPTEGtwpVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLF 857
Cdd:PRK05367  722 KAHLAPFLPGHPVQIAGGETG---IGAVSAAPFGSASILPISWMYIRMMGAEGLRQATEVAILNANYIAKRLKDHYPVLY 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   858 RGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAD 937
Cdd:PRK05367  799 TGANGRVAHECILDLRPLKESTGITVDDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKAELDRFCDAMIAIRAEIDE 878
                         890       900       910       920       930       940       950
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 20070408   938 IEEGRIDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKpENKFWPTIARIDDIYGDQHLVCTCPPMEVYE 1014
Cdd:PRK05367  879 VEAGEWPAEDNPLKNAPHTAADLVADEWDHPYSREQAAFPLPSLR-ANKYWPPVGRIDNVYGDRNLVCSCPPIEAYA 954
gcvP TIGR00461
glycine dehydrogenase (decarboxylating); This apparently ubiquitous enzyme is found in ...
71-1007 0e+00

glycine dehydrogenase (decarboxylating); This apparently ubiquitous enzyme is found in bacterial, mammalian and plant sources. The enzyme catalyzes the reaction: GLYCINE + LIPOYLPROTEIN = S-AMINOMETHYL-DIHYDROLIPOYLPROTEIN + CO2. It is part of the glycine decarboxylase multienzyme complex (GDC) consisting of four proteins P, H, L and T. Active site in E.coli is located as the (K) residues at position 713 of the SEED alignment. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273089 [Multi-domain]  Cd Length: 939  Bit Score: 1320.69  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408     71 RHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYNCSVPQ 150
Cdd:TIGR00461    1 RHLGPGETEQRQMLQTLGFDTLNALIDQAVPPAIRFPRPLQLPAPQSEYGALAQLKSIASKNQVFRSYIGMGYYDTILPP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    151 TILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRK--KFFVDP 228
Cdd:TIGR00461   81 VIQRNILENPGWYTAYTPYQPEISQGRLEALLNFQTVVMDLTGLEIANASLLDEGTAAAEAMALSYGVSKSKanAFFVAQ 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    229 RCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSgKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCATDLLALCILR 308
Cdd:TIGR00461  161 DCHPQTIEVIKTRANPFGIEVIVGDHHTFSFS-TDVFGALLQYPATDGAIYDYRSLIDKLHSHKALVSVAADPMALTLLT 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    309 PPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICT 388
Cdd:TIGR00461  240 PPGELGADIVVGSTQRFGVPMGYGGPHAAFFATKDEYQRKMPGRIVGVSKDAHGNTALRLALQTREQHIRRDKATSNICT 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    389 AQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCG-CSVKEVLGRAAQRQINFRL 467
Cdd:TIGR00461  320 AQVLLANMASMYGVYHGPTGLKNIALRIHQLTVILAIGLKRLNYSLNNDYFFDTLRVGVGeQSAPAILKAAEGRGINLRP 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    468 FDDGTLGISLDETVTEKDLDDLLWIFGCESSAELVAEGMGEERRGLLGSSFKRTSPFLTHQVFNSYHSETNLVRYMKKLE 547
Cdd:TIGR00461  400 LVPGEVGISLDETTTVQDVLDLWQVFAGKDNLPFTPEELWSDVKTSFPADLTRQDEILQDAVFNQYHSETEMLRYLHQLE 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    548 NKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGE 627
Cdd:TIGR00461  480 SKDLALNTSMIPLGSCTMKLNATAEMMPITWPEFGKIHPFAPAGQTEGYQILIAQLEAWLGEITGFDAISLQPNSGAQGE 559
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    628 YAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENLAAIMITYPST 707
Cdd:TIGR00461  560 YAGLQVIRQYHESRGEEHRNICLIPESAHGTNPASAVMAGMQVVPVKCDGEGNIDLEDLTSKAEQYGDRLAALMVTYPST 639
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    708 NGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLSPFLPS 787
Cdd:TIGR00461  640 HGVFEATIGTICDIVHRFGGQVYLDGANMNAQVGLTSPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLQPFLPR 719
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    788 HPVISIKPTEG-TWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLFRGARGYVAH 866
Cdd:TIGR00461  720 HSLNSTAELQGeDQSIGMVSAAPYGSASILPISWMYIAMMGPEGLTKASEVAILNANYMAKRLEDYYPILFRGNNELVAH 799
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    867 EFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPR 946
Cdd:TIGR00461  800 ECILDLRPLKKQAGIEVEDVAKRLMDYGFHAPTVSFPVLGTLMVEPTESESLGELDRFCDAMIAIYQEIQAITAGEIDPA 879
                          890       900       910       920       930       940
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 20070408    947 VNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKpENKFWPTIARIDDIYGDQHLVCTC 1007
Cdd:TIGR00461  880 DNPLKNAPHTAQSLICGEWNHPYSREEAAYPAPWTK-QFKFWPTVGRLDDTYGDRNLVCSC 939
GDC-P pfam02347
Glycine cleavage system P-protein; This family consists of Glycine cleavage system P-proteins ...
70-493 0e+00

Glycine cleavage system P-protein; This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1.2.10 (GDC) also annotated as glycine cleavage system or glycine synthase. GDC consists of four proteins P, H, L and T. The reaction catalyzed by this protein is:- Glycine + lipoylprotein <=> S-aminomethyldihydrolipoylprotein + CO2


Pssm-ID: 396772  Cd Length: 428  Bit Score: 766.92  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408     70 RRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYNCSVP 149
Cdd:pfam02347    1 DRHIGPSEKDQQEMLATLGYSSLDDLIGKAVPKNIRFAKPLQLPAPKSEYEALAELEAIASKNTVYRSFIGMGYYDTILP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    150 QTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRK--KFFVD 227
Cdd:pfam02347   81 PVILRNILENPEWYTAYTPYQPEISQGRLEALLNFQTMICDLTGLDIANASLLDEGTAAAEAMALAARASKKKgkKFVVD 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    228 PRCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSG-KDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCATDLLALCI 306
Cdd:pfam02347  161 KDVHPQTLEVLKTRAKPFGIEIVEVDYTEEGVTDlKDVFGVLVQYPNTDGRIEDYKELIELAHQRKSLVVVAADLLALTL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    307 LRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNI 386
Cdd:pfam02347  241 LKPPGEFGADIAVGSAQRFGVPLGYGGPHAGFFAVKKELVRKMPGRLVGVSKDANGKRALRLALQTREQHIRRDKATSNI 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    387 CTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCG-CSVKEVLGRAAQRQINF 465
Cdd:pfam02347  321 CTAQALLANMASMYAVYHGPNGLKEIARRIHSLTLYLAKALKKLGHELVHKHFFDTLLIEVEdKAVEEVLARAEARGINL 400
                          410       420
                   ....*....|....*....|....*...
gi 20070408    466 RLFDDGTLGISLDETVTEKDLDDLLWIF 493
Cdd:pfam02347  401 RYVDLGHVGIALDETVTKEDIDDLLQVF 428
GcvP2 COG1003
Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport ...
509-982 0e+00

Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism];


Pssm-ID: 223935  Cd Length: 496  Bit Score: 719.08  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  509 ERRGLLGSSFKRTS--PFLTHQVFNSY-----HSETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREF 581
Cdd:COG1003   13 SRTGRTGYSLPEQVveEYLPHPVFRRYpplpeHSETEMVRHYTRLSQKDLAVDRGMIPLGSCTMKLNPKAEMKPATWPEF 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  582 ANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPA 661
Cdd:COG1003   93 ANIHPFQPEEQVQGYLELIYELQEWLKEITGMDAVSLQPNAGAQGEYAGLLAIRAYHESRGEGHRNICLIPDSAHGTNPA 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  662 SAHMAGMKIQPVEVDRYGNIDVAHLKAMVDqhkENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVG 741
Cdd:COG1003  173 SAAMAGFKVVVVKCDENGNVDLDDLRAKAE---DNLAALMITNPSTLGVFEEDIREICEIVHEAGGQVYYDGANLNAIVG 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  742 ICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLSPFLPS----HPVISIKPTEGTWPVGTVSAAPWGSSSILP 817
Cdd:COG1003  250 LARPGDMGFDVVHLNLHKTFCIPHGGGGPGAGPVGVKAHLAPFLPGpvvyHDVGEYRLDYDGKKSIGVSAAPYGSASILP 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  818 ISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLFRGaRGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHA 897
Cdd:COG1003  330 IAWAYIRMMGADGLKQASEVAVLNANYIARRLKGYYPVPYTG-ENRVAHECILDARPLKKETGVRALDVAKRLLDYGFHA 408
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  898 PTMSWP--VAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGriDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAA 975
Cdd:COG1003  409 PTMYFPliVAGTLMIEPTESESKEELDRFIDAMIAIREEADAVPAG--PLKDNPLNTAPHRLDELLAARWDHPYSREEAA 486

                 ....*..
gi 20070408  976 FPLPFVK 982
Cdd:COG1003  487 YPLGKLR 493
GDC-P cd00613
Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine ...
118-493 3.18e-176

Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1.2.10 (GDC) also annotated as glycine cleavage system or glycine synthase. GDC consists of four proteins P, H, L and T. The reaction catalysed by this protein is: Glycine + lipoylprotein <=> S-aminomethyldihydrolipoylprotein + CO2. Alpha-beta-type dimers associate to form an alpha(2)beta(2) tetramer, where the alpha- and beta-subunits are structurally similar and appear to have arisen by gene duplication and subsequent divergence with a loss of one active site. The members of this CD are widely dispersed among all three forms of cellular life.


Pssm-ID: 99737 [Multi-domain]  Cd Length: 398  Bit Score: 519.10  E-value: 3.18e-176
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  118 ENEILETLHAIASKNQIWR---SYIGMGYYNCSVPQTILRNLLENsGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGL 194
Cdd:cd00613    1 ETEVLRHLKRLASKNKALDqsmSFLGSGTYKHNPPAVIKRNILEN-EFYTAYTPYQPEISQGRLQALFELQTMLCELTGM 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  195 DMANASLLDEATAAAEAMQLCHRHNK--RKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEM---------DFSGKD 263
Cdd:cd00613   80 DVANASLQDEATAAAEAAGLAAIRAYhkRNKVLVPDSAHPTNPAVARTRGEPLGIEVVEVPSDEGgtvdlealkEEVSEE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  264 VCGVLFQYPDTEGKVEDF-TELVDRAHQTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVK 342
Cdd:cd00613  160 VAALMVQYPNTLGVFEDLiKEIADIAHSAGALVYVDGDNLNLTGLKPPGEYGADIVVGNLQKTGVPHGGGGPGAGFFAVK 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  343 ENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLI 422
Cdd:cd00613  240 KELVRFLPGRLVGVTKDAEGNRAFRLALQTREQHIRREKATSNICTGQALLALMAAMYIVYLGPEGLKEIAERAHLNANY 319
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 20070408  423 LSEGLKRAGHQLQ-HDLFFDTLKVQCGC---SVKEVLGRAAQRQINFR----LFDDGTLGISLDETVTEKDLDDLLWIF 493
Cdd:cd00613  320 LAKRLKEVGGVLPfNGPFFHEFVLRLPPlygIRAEDLAKALIDGGFHAptmyLPVDGTLMIEPTETETKEELDALLEAL 398
 
Name Accession Description Interval E-value
PRK05367 PRK05367
aminomethyl-transferring glycine dehydrogenase;
62-1014 0e+00

aminomethyl-transferring glycine dehydrogenase;


Pssm-ID: 235432 [Multi-domain]  Cd Length: 954  Bit Score: 1740.77  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    62 LPRHDDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGM 141
Cdd:PRK05367    4 LENSDAFARRHIGPSAADQQAMLAALGADSLDALIDQAVPASIRLAEPLDLPAALSEAEALAELRAIASKNKVFRSYIGQ 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   142 GYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKR 221
Cdd:PRK05367   84 GYYGTHTPPVILRNILENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGLEIANASLLDEATAAAEAMALAKRVSKS 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   222 K--KFFVDPRCHPQTIAVVQTRAKYRGVlvELKL-PHEMDFSGKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCA 298
Cdd:PRK05367  164 KsnRFFVDDDVHPQTLDVLRTRAEPLGI--EVVVgDAAKALDHDDVFGVLLQYPGTSGEVRDYTALIAAAHARGALVAVA 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   299 TDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIR 378
Cdd:PRK05367  242 ADLLALTLLTPPGEMGADIAVGSAQRFGVPMGFGGPHAAYFAVRDAYKRSMPGRIVGVSVDAAGNPALRLALQTREQHIR 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   379 RDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCGCSVKEVLGRA 458
Cdd:PRK05367  322 REKATSNICTAQVLLAVMASMYAVYHGPEGLKAIARRVHRLAAILAAGLRALGLEVVHDSFFDTLTVEVGGDAAAVLARA 401
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   459 AQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGC-ESSAELVAEGMGEERRGLLGSSFKRTSPFLTHQVFNSYHSET 537
Cdd:PRK05367  402 LAAGINLRRVDDDHVGISLDETTTREDLAALLAVFGGaALDVDALDADVADASASALPAALLRTSAYLTHPVFNRYHSET 481
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   538 NLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVS 617
Cdd:PRK05367  482 EMMRYLRRLEDKDLALDRSMIPLGSCTMKLNAAAEMIPITWPEFANLHPFAPAEQAAGYRELIDQLEAWLAEITGYDAVS 561
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   618 FQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENL 697
Cdd:PRK05367  562 LQPNAGAQGEYAGLLAIRAYHESRGEGHRDVCLIPSSAHGTNPASAVMAGMKVVVVACDENGNIDLDDLRAKAEEHADNL 641
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   698 AAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIphggggpgmgpigV 777
Cdd:PRK05367  642 AAIMITYPSTHGVFEETIREICEIVHEHGGQVYLDGANMNAQVGLARPGDIGADVSHLNLHKTFCIphggggpgvgpigV 721
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   778 KKHLSPFLPSHPVISIKPTEGtwpVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLF 857
Cdd:PRK05367  722 KAHLAPFLPGHPVQIAGGETG---IGAVSAAPFGSASILPISWMYIRMMGAEGLRQATEVAILNANYIAKRLKDHYPVLY 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   858 RGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAD 937
Cdd:PRK05367  799 TGANGRVAHECILDLRPLKESTGITVDDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKAELDRFCDAMIAIRAEIDE 878
                         890       900       910       920       930       940       950
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 20070408   938 IEEGRIDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKpENKFWPTIARIDDIYGDQHLVCTCPPMEVYE 1014
Cdd:PRK05367  879 VEAGEWPAEDNPLKNAPHTAADLVADEWDHPYSREQAAFPLPSLR-ANKYWPPVGRIDNVYGDRNLVCSCPPIEAYA 954
PLN02414 PLN02414
glycine dehydrogenase (decarboxylating)
56-1014 0e+00

glycine dehydrogenase (decarboxylating)


Pssm-ID: 178035 [Multi-domain]  Cd Length: 993  Bit Score: 1500.81  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    56 RLLERLLPRH------------DDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRlKRPLKME---DPICENE 120
Cdd:PLN02414   11 GLLRRLVNEQtrsisvealkpsDTFPRRHNSATPEEQKAMAEYCGFDSLDALIDATVPKSIR-LDSMKLSkydEGLTESQ 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   121 ILETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANAS 200
Cdd:PLN02414   90 MLEHMKSLASKNKVFKSYIGMGYYNTHVPPVILRNILENPGWYTQYTPYQAEIAQGRLESLLNYQTMITDLTGLPMSNAS 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   201 LLDEATAAAEAMQLCHRHN--KRKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSGKDVCGVLFQYPDTEGKV 278
Cdd:PLN02414  170 LLDEGTAAAEAMAMCNNILkgKKKKFLIASNCHPQTIDVCQTRADGLGLEVVVADEKDFDYSSGDVCGVLVQYPATDGEV 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   279 EDFTELVDRAHQTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTR 358
Cdd:PLN02414  250 LDYAEFVKNAHANGVKVVMATDLLALTMLKPPGEWGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRLMPGRIIGVSV 329
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   359 DATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDL 438
Cdd:PLN02414  330 DSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIAQRVHGLAGVFAAGLKKLGFQVQSLP 409
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   439 FFDTLKVQCGcSVKEVLGRAAQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGCESSAELVAEGMGEERRGLLGSSF 518
Cdd:PLN02414  410 FFDTVKVKCS-DADAIADAAAKVGINLRVVDANTVTVSFDETTTLEDVDKLFKVFAGGKPVPFTAESLAPEVDSSIPSSL 488
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   519 KRTSPFLTHQVFNSYHSETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQ 598
Cdd:PLN02414  489 ARESPYLTHPIFNQYHSEHELLRYLHRLQNKDLSLVHSMIPLGSCTMKLNATTEMMPVTWPEFANIHPFAPVDQAQGYQE 568
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   599 LFQGLEKDLCEITGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRY 678
Cdd:PLN02414  569 MFEDLGDLLCEITGFDSFSLQPNAGAAGEYAGLMVIRAYHLSRGDHHRNVCIIPVSAHGTNPASAAMCGMKIVVVGTDAK 648
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   679 GNIDVAHLKAMVDQHKENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLH 758
Cdd:PLN02414  649 GNINIEELRKAAEAHKDNLAALMVTYPSTHGVYEEGIDEICDIIHDNGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLH 728
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   759 KTFCIPHGGGGPGMGPIGVKKHLSPFLPSHPVI---SIKPTEGTWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEAT 835
Cdd:PLN02414  729 KTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVptgGIPRPEKTQPLGTISAAPWGSALILPISYTYIAMMGSEGLTDAS 808
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   836 EIAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTES 915
Cdd:PLN02414  809 KIAILNANYMAKRLEGHYPVLFRGKNGTCAHEFIIDLRPFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLMIEPTES 888
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   916 EDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKpENKFWPTIARID 995
Cdd:PLN02414  889 ESKAELDRFCDALISIREEIADIENGKADRENNVLKGAPHPPSLLMADKWDKPYSREYAAFPAPWVR-ASKFWPTTGRVD 967
                         970
                  ....*....|....*....
gi 20070408   996 DIYGDQHLVCTCPPMEVYE 1014
Cdd:PLN02414  968 NVYGDRNLVCTLPSAAEEE 986
gcvP TIGR00461
glycine dehydrogenase (decarboxylating); This apparently ubiquitous enzyme is found in ...
71-1007 0e+00

glycine dehydrogenase (decarboxylating); This apparently ubiquitous enzyme is found in bacterial, mammalian and plant sources. The enzyme catalyzes the reaction: GLYCINE + LIPOYLPROTEIN = S-AMINOMETHYL-DIHYDROLIPOYLPROTEIN + CO2. It is part of the glycine decarboxylase multienzyme complex (GDC) consisting of four proteins P, H, L and T. Active site in E.coli is located as the (K) residues at position 713 of the SEED alignment. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273089 [Multi-domain]  Cd Length: 939  Bit Score: 1320.69  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408     71 RHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYNCSVPQ 150
Cdd:TIGR00461    1 RHLGPGETEQRQMLQTLGFDTLNALIDQAVPPAIRFPRPLQLPAPQSEYGALAQLKSIASKNQVFRSYIGMGYYDTILPP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    151 TILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRK--KFFVDP 228
Cdd:TIGR00461   81 VIQRNILENPGWYTAYTPYQPEISQGRLEALLNFQTVVMDLTGLEIANASLLDEGTAAAEAMALSYGVSKSKanAFFVAQ 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    229 RCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSgKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCATDLLALCILR 308
Cdd:TIGR00461  161 DCHPQTIEVIKTRANPFGIEVIVGDHHTFSFS-TDVFGALLQYPATDGAIYDYRSLIDKLHSHKALVSVAADPMALTLLT 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    309 PPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICT 388
Cdd:TIGR00461  240 PPGELGADIVVGSTQRFGVPMGYGGPHAAFFATKDEYQRKMPGRIVGVSKDAHGNTALRLALQTREQHIRRDKATSNICT 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    389 AQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCG-CSVKEVLGRAAQRQINFRL 467
Cdd:TIGR00461  320 AQVLLANMASMYGVYHGPTGLKNIALRIHQLTVILAIGLKRLNYSLNNDYFFDTLRVGVGeQSAPAILKAAEGRGINLRP 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    468 FDDGTLGISLDETVTEKDLDDLLWIFGCESSAELVAEGMGEERRGLLGSSFKRTSPFLTHQVFNSYHSETNLVRYMKKLE 547
Cdd:TIGR00461  400 LVPGEVGISLDETTTVQDVLDLWQVFAGKDNLPFTPEELWSDVKTSFPADLTRQDEILQDAVFNQYHSETEMLRYLHQLE 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    548 NKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGE 627
Cdd:TIGR00461  480 SKDLALNTSMIPLGSCTMKLNATAEMMPITWPEFGKIHPFAPAGQTEGYQILIAQLEAWLGEITGFDAISLQPNSGAQGE 559
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    628 YAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENLAAIMITYPST 707
Cdd:TIGR00461  560 YAGLQVIRQYHESRGEEHRNICLIPESAHGTNPASAVMAGMQVVPVKCDGEGNIDLEDLTSKAEQYGDRLAALMVTYPST 639
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    708 NGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLSPFLPS 787
Cdd:TIGR00461  640 HGVFEATIGTICDIVHRFGGQVYLDGANMNAQVGLTSPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLQPFLPR 719
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    788 HPVISIKPTEG-TWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLFRGARGYVAH 866
Cdd:TIGR00461  720 HSLNSTAELQGeDQSIGMVSAAPYGSASILPISWMYIAMMGPEGLTKASEVAILNANYMAKRLEDYYPILFRGNNELVAH 799
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    867 EFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPR 946
Cdd:TIGR00461  800 ECILDLRPLKKQAGIEVEDVAKRLMDYGFHAPTVSFPVLGTLMVEPTESESLGELDRFCDAMIAIYQEIQAITAGEIDPA 879
                          890       900       910       920       930       940
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 20070408    947 VNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKpENKFWPTIARIDDIYGDQHLVCTC 1007
Cdd:TIGR00461  880 DNPLKNAPHTAQSLICGEWNHPYSREEAAYPAPWTK-QFKFWPTVGRLDDTYGDRNLVCSC 939
PRK12566 PRK12566
glycine dehydrogenase; Provisional
66-1013 0e+00

glycine dehydrogenase; Provisional


Pssm-ID: 171585 [Multi-domain]  Cd Length: 954  Bit Score: 1210.52  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    66 DDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYN 145
Cdd:PRK12566   11 DAFLRRHLGPDAAEQQAMLDALGVASRAELIEQTVPPAIRLNRPLDLPAALDEQAALARLRGYAEQNQVWTSLIGMGYHG 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   146 CSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHR--HNKRKK 223
Cdd:PRK12566   91 TVTPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMTIDLTGLDLANASLLDEATAAAEAMALAKRvaKSKSNR 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   224 FFVDPRCHPQTIAVVQTRAKyrGVLVELKLPHEMDFSGKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCATDLLA 303
Cdd:PRK12566  171 FFVDEHCHPQTLSVLRTRAE--GFGFELVVDAVDNLAAHAVFGALLQYPDTHGEIRDLRPLIDQLHGQQALACVAADLLS 248
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   304 LCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKAT 383
Cdd:PRK12566  249 LLVLTPPGELGADVVLGSTQRFGVPMGYGGPHAAYFACRDDYKRAMPGRIIGVSRDARGNTALRMALQTREQHIRREKAN 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   384 SNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCGCSVKEVLGRAAQRQI 463
Cdd:PRK12566  329 SNICTAQVLLANIAGFYAVYHGPEGLKRIAQRVHRLTAILAAGLEAKGIKRLNRHFFDTLTLEVGGAQAAIIESAEAARI 408
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   464 NFRLFDDGTLGISLDETVTEKDLDDLLWIF-GCESSAELVAEGMGEERRGLLGSsFKRTSPFLTHQVFNSYHSETNLVRY 542
Cdd:PRK12566  409 NLRILGRGRLGVSLDETCDEATVARLFDIFlGADHGLDVAALDQGALAEGIPAV-LQRRTAYLQHPVFNAHHSETEMLRY 487
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   543 MKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNS 622
Cdd:PRK12566  488 LKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWPEFAQLHPFAPREQAEGYRAMIDELEAWLCAITGFDAICMQPNS 567
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   623 GAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENLAAIMI 702
Cdd:PRK12566  568 GAQGEYAGLLAIRRYHRSRGQSQRDICLIPSSAHGTNPASAQMAGMRVVIVECDPDGNVDLDDLKAKAAAAGDRLSCLMI 647
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   703 TYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLS 782
Cdd:PRK12566  648 TYPSTHGVYEEGIREICEVVHQHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHKTFCIPHGGGGPGMGPIGVRAHLA 727
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   783 PFLPSHPVIsikPTEGTWPV-GTVSAAPWGSSSILPISWAYIKMMGGKgLKEATEIAILNANYMAKRLEKHYRVLFRGAR 861
Cdd:PRK12566  728 PFVANHPVV---PVEGPDPNnGAVSAAPWGSASILPISWMYIAMMGPQ-LADASEVAILSANYLANQLGGAFPVLYRGRN 803
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   862 GYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEG 941
Cdd:PRK12566  804 ERVAHECILDLRPLKAQTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKAELDRFVEAMLSIRAEIGKVQEG 883
                         890       900       910       920       930       940       950
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 20070408   942 RIDPRVNPLKMSPHSLTCVTSScWDRPYSREVAAFPLPFVKpENKFWPTIARIDDIYGDQHLVCTCPPMEVY 1013
Cdd:PRK12566  884 NWPAEDNPLKRAPHTLADVTGV-WQRPYSIEQAVTPSAHAR-AHKYWPAVNRVDNVYGDRNLFCACVPVDDY 953
GDC-P pfam02347
Glycine cleavage system P-protein; This family consists of Glycine cleavage system P-proteins ...
70-493 0e+00

Glycine cleavage system P-protein; This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1.2.10 (GDC) also annotated as glycine cleavage system or glycine synthase. GDC consists of four proteins P, H, L and T. The reaction catalyzed by this protein is:- Glycine + lipoylprotein <=> S-aminomethyldihydrolipoylprotein + CO2


Pssm-ID: 396772  Cd Length: 428  Bit Score: 766.92  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408     70 RRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYNCSVP 149
Cdd:pfam02347    1 DRHIGPSEKDQQEMLATLGYSSLDDLIGKAVPKNIRFAKPLQLPAPKSEYEALAELEAIASKNTVYRSFIGMGYYDTILP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    150 QTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRK--KFFVD 227
Cdd:pfam02347   81 PVILRNILENPEWYTAYTPYQPEISQGRLEALLNFQTMICDLTGLDIANASLLDEGTAAAEAMALAARASKKKgkKFVVD 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    228 PRCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSG-KDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCATDLLALCI 306
Cdd:pfam02347  161 KDVHPQTLEVLKTRAKPFGIEIVEVDYTEEGVTDlKDVFGVLVQYPNTDGRIEDYKELIELAHQRKSLVVVAADLLALTL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    307 LRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNI 386
Cdd:pfam02347  241 LKPPGEFGADIAVGSAQRFGVPLGYGGPHAGFFAVKKELVRKMPGRLVGVSKDANGKRALRLALQTREQHIRRDKATSNI 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    387 CTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQCG-CSVKEVLGRAAQRQINF 465
Cdd:pfam02347  321 CTAQALLANMASMYAVYHGPNGLKEIARRIHSLTLYLAKALKKLGHELVHKHFFDTLLIEVEdKAVEEVLARAEARGINL 400
                          410       420
                   ....*....|....*....|....*...
gi 20070408    466 RLFDDGTLGISLDETVTEKDLDDLLWIF 493
Cdd:pfam02347  401 RYVDLGHVGIALDETVTKEDIDDLLQVF 428
GcvP2 COG1003
Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport ...
509-982 0e+00

Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism];


Pssm-ID: 223935  Cd Length: 496  Bit Score: 719.08  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  509 ERRGLLGSSFKRTS--PFLTHQVFNSY-----HSETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREF 581
Cdd:COG1003   13 SRTGRTGYSLPEQVveEYLPHPVFRRYpplpeHSETEMVRHYTRLSQKDLAVDRGMIPLGSCTMKLNPKAEMKPATWPEF 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  582 ANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPA 661
Cdd:COG1003   93 ANIHPFQPEEQVQGYLELIYELQEWLKEITGMDAVSLQPNAGAQGEYAGLLAIRAYHESRGEGHRNICLIPDSAHGTNPA 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  662 SAHMAGMKIQPVEVDRYGNIDVAHLKAMVDqhkENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVG 741
Cdd:COG1003  173 SAAMAGFKVVVVKCDENGNVDLDDLRAKAE---DNLAALMITNPSTLGVFEEDIREICEIVHEAGGQVYYDGANLNAIVG 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  742 ICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLSPFLPS----HPVISIKPTEGTWPVGTVSAAPWGSSSILP 817
Cdd:COG1003  250 LARPGDMGFDVVHLNLHKTFCIPHGGGGPGAGPVGVKAHLAPFLPGpvvyHDVGEYRLDYDGKKSIGVSAAPYGSASILP 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  818 ISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLFRGaRGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHA 897
Cdd:COG1003  330 IAWAYIRMMGADGLKQASEVAVLNANYIARRLKGYYPVPYTG-ENRVAHECILDARPLKKETGVRALDVAKRLLDYGFHA 408
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  898 PTMSWP--VAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGriDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAA 975
Cdd:COG1003  409 PTMYFPliVAGTLMIEPTESESKEELDRFIDAMIAIREEADAVPAG--PLKDNPLNTAPHRLDELLAARWDHPYSREEAA 486

                 ....*..
gi 20070408  976 FPLPFVK 982
Cdd:COG1003  487 YPLGKLR 493
GcvP1 COG0403
Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport ...
62-494 0e+00

Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism];


Pssm-ID: 223480  Cd Length: 450  Bit Score: 624.65  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   62 LPRHDDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDP--ICENEILETLHAIASKNQIWRSYI 139
Cdd:COG0403    1 LEPLDAFMARHIGPSSADQQEMLAAIGVSSLDELFSQDIPPSIRKKLDTLLPLPkpLSEYEALAELKEIASKNKVFTSFI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  140 GMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHN 219
Cdd:COG0403   81 GAGYYDTYTPPVILRNILENPEWYTAYTPYQPEISQGRLEALFEFQTLVADLTGLDVANASMLDEATAAAEAMLMAKRVT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  220 K--RKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEMDF----SGKDVCGVLFQYPDTEGKVE-DFTELVDRAHQTG 292
Cdd:COG0403  161 KkkRNKFLVPKDVHPQTLDVLRTRAEGLGIEIEVVDADDLDDlesaDDGDVFGVLVQYPNTFGIVEeDLRALIEAAHSAG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  293 SLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQT 372
Cdd:COG0403  241 ALVIVAADPLALGLLKPPGEFGADIVVGSAQRFGVPMGFGGPHAGYFAVKDEFKRQMPGRLVGVSVDAAGKRAFRLALQT 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  373 REQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLK--RAGHQLQHDLFFDTLKVQCGCS 450
Cdd:COG0403  321 REQHIRREKATSNICTNQALLALAASMYAVYHGPQGLKEIAERIHRLAAYLAAGLKeiGAGVELVFDHFFDTFTVRVPEE 400
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 20070408  451 V-KEVLGRAAQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFG 494
Cdd:COG0403  401 VaEALLAAAIAGGINLRRVDADTVLIALTETTTKEDIDALVAAFG 445
GDC-P cd00613
Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine ...
118-493 3.18e-176

Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1.2.10 (GDC) also annotated as glycine cleavage system or glycine synthase. GDC consists of four proteins P, H, L and T. The reaction catalysed by this protein is: Glycine + lipoylprotein <=> S-aminomethyldihydrolipoylprotein + CO2. Alpha-beta-type dimers associate to form an alpha(2)beta(2) tetramer, where the alpha- and beta-subunits are structurally similar and appear to have arisen by gene duplication and subsequent divergence with a loss of one active site. The members of this CD are widely dispersed among all three forms of cellular life.


Pssm-ID: 99737 [Multi-domain]  Cd Length: 398  Bit Score: 519.10  E-value: 3.18e-176
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  118 ENEILETLHAIASKNQIWR---SYIGMGYYNCSVPQTILRNLLENsGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGL 194
Cdd:cd00613    1 ETEVLRHLKRLASKNKALDqsmSFLGSGTYKHNPPAVIKRNILEN-EFYTAYTPYQPEISQGRLQALFELQTMLCELTGM 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  195 DMANASLLDEATAAAEAMQLCHRHNK--RKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEM---------DFSGKD 263
Cdd:cd00613   80 DVANASLQDEATAAAEAAGLAAIRAYhkRNKVLVPDSAHPTNPAVARTRGEPLGIEVVEVPSDEGgtvdlealkEEVSEE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  264 VCGVLFQYPDTEGKVEDF-TELVDRAHQTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVK 342
Cdd:cd00613  160 VAALMVQYPNTLGVFEDLiKEIADIAHSAGALVYVDGDNLNLTGLKPPGEYGADIVVGNLQKTGVPHGGGGPGAGFFAVK 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  343 ENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLI 422
Cdd:cd00613  240 KELVRFLPGRLVGVTKDAEGNRAFRLALQTREQHIRREKATSNICTGQALLALMAAMYIVYLGPEGLKEIAERAHLNANY 319
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 20070408  423 LSEGLKRAGHQLQ-HDLFFDTLKVQCGC---SVKEVLGRAAQRQINFR----LFDDGTLGISLDETVTEKDLDDLLWIF 493
Cdd:cd00613  320 LAKRLKEVGGVLPfNGPFFHEFVLRLPPlygIRAEDLAKALIDGGFHAptmyLPVDGTLMIEPTETETKEELDALLEAL 398
GDC-P cd00613
Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine ...
536-928 1.34e-158

Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1.2.10 (GDC) also annotated as glycine cleavage system or glycine synthase. GDC consists of four proteins P, H, L and T. The reaction catalysed by this protein is: Glycine + lipoylprotein <=> S-aminomethyldihydrolipoylprotein + CO2. Alpha-beta-type dimers associate to form an alpha(2)beta(2) tetramer, where the alpha- and beta-subunits are structurally similar and appear to have arisen by gene duplication and subsequent divergence with a loss of one active site. The members of this CD are widely dispersed among all three forms of cellular life.


Pssm-ID: 99737 [Multi-domain]  Cd Length: 398  Bit Score: 473.64  E-value: 1.34e-158
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  536 ETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWR-EFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYD 614
Cdd:cd00613    1 ETEVLRHLKRLASKNKALDQSMSFLGSGTYKHNPPAVIKRNILEnEFYTAYTPYQPEISQGRLQALFELQTMLCELTGMD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  615 --RVSFQPNSGAQGEYAGLATIRAYLdqkgerHRTVCLIPKSAHGTNPASAHMA----GMKIQPVEVDRYGNIDvahLKA 688
Cdd:cd00613   81 vaNASLQDEATAAAEAAGLAAIRAYH------KRNKVLVPDSAHPTNPAVARTRgeplGIEVVEVPSDEGGTVD---LEA 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  689 MVDQHKENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQvGICRPGDFGSDVSHLNLHKTF------- 761
Cdd:cd00613  152 LKEEVSEEVAALMVQYPNTLGVFEDLIKEIADIAHSAGALVYVDGDNLNLT-GLKPPGEYGADIVVGNLQKTGvphgggg 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  762 ------CiphggggpgmgpigVKKHLSPFLPSHPVISIKPTEGTwPVGTVSAA---------------PWGSSSILPISW 820
Cdd:cd00613  231 pgagffA--------------VKKELVRFLPGRLVGVTKDAEGN-RAFRLALQtreqhirrekatsniCTGQALLALMAA 295
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  821 AYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLfrGARGYVAHEFILDTRPFkksANVEAVDVAKRLQDYGFHAPTM 900
Cdd:cd00613  296 MYIVYLGPEGLKEIAERAHLNANYLAKRLKEVGGVL--PFNGPFFHEFVLRLPPL---YGIRAEDLAKALIDGGFHAPTM 370
                        410       420
                 ....*....|....*....|....*...
gi 20070408  901 SWPVAGTLMIEPTESEDKAELDRFCDAM 928
Cdd:cd00613  371 YLPVDGTLMIEPTETETKEELDALLEAL 398
PRK04366 PRK04366
aminomethyl-transferring glycine dehydrogenase subunit GcvPB;
535-958 2.31e-143

aminomethyl-transferring glycine dehydrogenase subunit GcvPB;


Pssm-ID: 235292  Cd Length: 481  Bit Score: 437.24  E-value: 2.31e-143
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   535 SETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNssselaP-ITWR-----EFANIHPFVPLDQAQGYQQLFQGLEKDLC 608
Cdd:PRK04366   50 SELEVVRHYTRLSQKNYGVDTGFYPLGSCTMKYN------PkINEKvarlpGFAELHPLQPEETVQGALELMYELQEWLK 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   609 EITGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKA 688
Cdd:PRK04366  124 EITGMDAVTLQPAAGAHGELTGLLMIRAYHEARGDTKRTEVIVPDSAHGTNPASAAMAGFKVVEIPSNEDGLVDLEALKA 203
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   689 MVDqhkENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGG 768
Cdd:PRK04366  204 AVG---EDTAALMLTNPNTLGLFERNILEIAEIVHEAGGLLYYDGANLNAILGKARPGDMGFDVVHLNLHKTFSTPHGGG 280
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   769 GPGMGPIGVKKHLSPFLPsHPVisIKPTEGTW--------PVGTVSAApWGSSSILPISWAYIKMMGGKGLKEATEIAIL 840
Cdd:PRK04366  281 GPGSGPVGVKEELAPFLP-VPV--VEKDGDRYrldydrpkSIGRVRAF-YGNFGVLVRAYAYIRSLGAEGLREVSEDAVL 356
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   841 NANYMAKRLEKHYRVLFRGARgyvAHEFILDTRPFKKSaNVEAVDVAKRLQDYGFHAPTMSWP--VAGTLMIEPTESEDK 918
Cdd:PRK04366  357 NANYLKARLKDIYDLPYDRPC---MHEFVLSGKKLKET-GVRTLDIAKRLLDYGFHPPTIYFPliVPEALMIEPTETESK 432
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|
gi 20070408   919 AELDRFCDAMISIRqeiadiEEGRIDPRVnpLKMSPHSLT 958
Cdd:PRK04366  433 ETLDAFIAAMKQIA------EEAKENPEL--VKEAPHNTP 464
PRK00451 PRK00451
aminomethyl-transferring glycine dehydrogenase subunit GcvPA;
77-489 1.03e-124

aminomethyl-transferring glycine dehydrogenase subunit GcvPA;


Pssm-ID: 234769  Cd Length: 447  Bit Score: 387.19  E-value: 1.03e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    77 DKDRREMLQALGLASIDELIEKtVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWR---SYIGMGYYNCSVPqTIL 153
Cdd:PRK00451    9 EEDIREMLDAIGVKSIDELFAD-IPEELRLKRPLDLPPGLSEMELLRHLRELAAKNKTAEeypSFLGAGAYDHYIP-AVV 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   154 RNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRKKFFVDPRCHPQ 233
Cdd:PRK00451   87 DHIISRSEFYTAYTPYQPEISQGTLQAIFEYQTMICELTGMDVANASMYDGATALAEAALMAVRITKRKKVLVSGAVHPE 166
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   234 TIAVVQTRAKYRGV-LVELKLPHEM-------DFSGKDVCGVLFQYPDTEGKVEDFTELVDRAHQTGSLTCCATDLLALC 305
Cdd:PRK00451  167 YREVLKTYLKGQGIeVVEVPYEDGVtdlealeAAVDDDTAAVVVQYPNFFGVIEDLEEIAEIAHAGGALFIVGVDPVSLG 246
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   306 ILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSN 385
Cdd:PRK00451  247 LLKPPGEYGADIVVGEGQPLGIPLSFGGPYLGFFATRKKLVRQMPGRLVGETVDADGKRGFVLTLQAREQHIRREKATSN 326
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   386 ICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHDL-FFDTLKVQCGCSVKEVLGRAAQRQI- 463
Cdd:PRK00451  327 ICTNQALNALAAAIYMSLLGPEGLRELAEQNHQKAHYLAERLAEIGGVELFDGpFFNEFVVRLPKPAEEVNEALLEKGIl 406
                         410       420       430
                  ....*....|....*....|....*....|...
gi 20070408   464 -------NFRLFDDGTLgISLDETVTEKDLDDL 489
Cdd:PRK00451  407 ggydlgrYYPELGNHLL-VCVTEKRTKEDIDAL 438
AAT_I cd01494
Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP) ...
603-762 1.45e-10

Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis has revealed that the PLP dependent enzymes can be classified into four major groups of different evolutionary origin: aspartate aminotransferase superfamily (fold type I), tryptophan synthase beta superfamily (fold type II), alanine racemase superfamily (fold type III), and D-amino acid superfamily (fold type IV) and Glycogen phophorylase family (fold type V).


Pssm-ID: 99742 [Multi-domain]  Cd Length: 170  Bit Score: 60.86  E-value: 1.45e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  603 LEKDLCEIT--GYDRVSFQPnSGAQGEYAGLATIRayldqkgERHRTVcLIPKSAHGTNPAS-AHMAGMKIQPVEVDRYG 679
Cdd:cd01494    5 LEEKLARLLqpGNDKAVFVP-SGTGANEAALLALL-------GPGDEV-IVDANGHGSRYWVaAELAGAKPVPVPVDDAG 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  680 NiDVAHLKAMVD-QHKENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGI--CRPGDFGSDVSHLN 756
Cdd:cd01494   76 Y-GGLDVAILEElKAKPNVALIVITPNTTSGGVLVPLKEIRKIAKEYGILLLVDAASAGGASPApgVLIPEGGADVVTFS 154

                 ....*.
gi 20070408  757 LHKTFC 762
Cdd:cd01494  155 LHKNLG 160
Beta_elim_lyase pfam01212
Beta-eliminating lyase;
591-734 3.24e-06

Beta-eliminating lyase;


Pssm-ID: 395968 [Multi-domain]  Cd Length: 283  Bit Score: 49.89  E-value: 3.24e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408    591 DQAQGYQQLFQGLEKDLCEITGYDRVSFQPnSGAQGEYAGLATirayLDQKGerHRTVCLIPksAHG---TNPASAHMAG 667
Cdd:pfam01212   25 DEVYGGDPTVNRLEDRVAELFGKEAALFVP-SGTAANQLALMA----HCQRG--DEVICGEP--AHIhfdETGGHAELGG 95
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 20070408    668 MKIQPVEVDRYGNIDVAHLKAMVDQHK----ENLAAIMITypSTNG------VFEENIGDVCALIHQHGGQVYLDGA 734
Cdd:pfam01212   96 VQPVPLDGDEAGNMDLEKLEAAIREVGadifPPTGLISLE--NTHNsaggqvVSLENLREIAALAREHGIPVHLDGA 170
GcvP2 COG1003
Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport ...
168-489 1.21e-05

Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism];


Pssm-ID: 223935  Cd Length: 496  Bit Score: 48.83  E-value: 1.21e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  168 PYQPEVS-QGRLESLLNYQTMVSDITGldMANASLLDEATAAAE--------AMQLCHRHNKRKKFFVDPRCH---PQTI 235
Cdd:COG1003   97 PFQPEEQvQGYLELIYELQEWLKEITG--MDAVSLQPNAGAQGEyagllairAYHESRGEGHRNICLIPDSAHgtnPASA 174
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  236 A-------VVQTRAKYRGVLVELKLPhemdfSGKDVCGVLFQYPDTEGKVE-DFTELVDRAHQTGSLTCC-ATDLLALCI 306
Cdd:COG1003  175 AmagfkvvVVKCDENGNVDLDDLRAK-----AEDNLAALMITNPSTLGVFEeDIREICEIVHEAGGQVYYdGANLNAIVG 249
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  307 LRPPGEFGVDIALGNSQR-FGVPLGYGGPHAAFFAVKENLVRMMPGRmvgVTRDATGKevYRLAlQTREQHIRRDKATsn 385
Cdd:COG1003  250 LARPGDMGFDVVHLNLHKtFCIPHGGGGPGAGPVGVKAHLAPFLPGP---VVYHDVGE--YRLD-YDGKKSIGVSAAP-- 321
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  386 icTAQALLANMAAMFAIYHGSQGLKHIAKR-VHNATLI---LSEGLK---RAGHQLQHDLFFDT--LKVQCGCSVKEVlg 456
Cdd:COG1003  322 --YGSASILPIAWAYIRMMGADGLKQASEVaVLNANYIarrLKGYYPvpyTGENRVAHECILDArpLKKETGVRALDV-- 397
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 20070408  457 raAQRQIN---------FRLFDDGTLGISLDETVTEKDLDDL 489
Cdd:COG1003  398 --AKRLLDygfhaptmyFPLIVAGTLMIEPTESESKEELDRF 437
PRK00451 PRK00451
aminomethyl-transferring glycine dehydrogenase subunit GcvPA;
822-928 2.44e-05

aminomethyl-transferring glycine dehydrogenase subunit GcvPA;


Pssm-ID: 234769  Cd Length: 447  Bit Score: 47.83  E-value: 2.44e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408   822 YIKMMGGKGLKEATEIAILNANYMAKRLEKH-YRVLFRGARGyvaHEFILDTrpfkksaNVEAVDVAKRLQDYGFHA--- 897
Cdd:PRK00451  341 YMSLLGPEGLRELAEQNHQKAHYLAERLAEIgGVELFDGPFF---NEFVVRL-------PKPAEEVNEALLEKGILGgyd 410
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 20070408   898 -----PTMswpvAGTLMIEPTESEDKAELDRFCDAM 928
Cdd:PRK00451  411 lgryyPEL----GNHLLVCVTEKRTKEDIDALVAAL 442
GcvP1 COG0403
Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport ...
663-752 2.14e-04

Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism];


Pssm-ID: 223480  Cd Length: 450  Bit Score: 44.93  E-value: 2.14e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  663 AHMAGMKIQPVEVDrygniDVAHLKAMVDQhkeNLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLdGANMNAQVGI 742
Cdd:COG0403  185 AEGLGIEIEVVDAD-----DLDDLESADDG---DVFGVLVQYPNTFGIVEEDLRALIEAAHSAGALVIV-AADPLALGLL 255
                         90
                 ....*....|
gi 20070408  743 CRPGDFGSDV 752
Cdd:COG0403  256 KPPGEFGADI 265
DOPA_deC_like cd06450
DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent ...
628-734 7.24e-04

DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and glutamate decarboxylase (GDC). DDC is active as a dimer and catalyzes the decarboxylation of tyrosine. GDC catalyzes the decarboxylation of glutamate and HDC catalyzes the decarboxylation of histidine.


Pssm-ID: 99743  Cd Length: 345  Bit Score: 42.96  E-value: 7.24e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  628 YAGLAT---IRAYLDQKGER--HRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHK-ENLAAIM 701
Cdd:cd06450   72 LALLAArdrARKRLKAGGGRgiDKLVIVCSDQAHVSVEKAAAYLDVKVRLVPVDEDGRMDPEALEAAIDEDKaEGLNPIM 151
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 20070408  702 I--TYPSTN-GVFE--ENIGDVCaliHQHGGQVYLDGA 734
Cdd:cd06450  152 VvaTAGTTDtGAIDplEEIADLA---EKYDLWLHVDAA 186
BioF COG0156
7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism];
595-732 2.63e-03

7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism];


Pssm-ID: 223234 [Multi-domain]  Cd Length: 388  Bit Score: 41.08  E-value: 2.63e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20070408  595 GYQQLFQGLEKDLCEITGYDR-VSFQpnsgaQGEYAGLATIRAYLDQKgerhrTVCLIPKSAHgtnpASAHmAGMKIQPV 673
Cdd:COG0156   81 GTSDLHVELEEELADFLGAEAaLLFS-----SGFVANLGLLSALLKKG-----DLIFSDELNH----ASII-DGIRLSRA 145
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 20070408  674 EVDRYGNIDVAHLKAMVDQHKENLAA-IMITypsTNGVFeENIGDV------CALIHQHGGQVYLD 732
Cdd:COG0156  146 EVRRFKHNDLDHLEALLEEARENGARrKLIV---TEGVF-SMDGDIaplpelVELAEKYGALLYVD 207
tnaA PRK13238
tryptophanase;
679-734 4.08e-03

tryptophanase;


Pssm-ID: 237314  Cd Length: 460  Bit Score: 40.95  E-value: 4.08e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 20070408   679 GNIDVAHLKAMVDQH-KENLAAIMITypSTNG------VFEENIGDVCALIHQHGGQVYLDGA 734
Cdd:PRK13238  159 GNFDLEKLEALIEEVgAENVPFIVMT--ITNNsaggqpVSMANLRAVYEIAKKYGIPVVIDAA 219
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH