NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21314828|ref|NP_647452|]
View 

anaphase-promoting complex subunit CDC26 [Mus musculus]

Protein Classification

CDC26 family anaphase-promoting complex subunit( domain architecture ID 10564601)

cell division cycle 26 (CDC26) family anaphase-promoting complex subunit is a component of the anaphase-promoting complex/cyclosome (APC/C) and is essential for stabilizing the structure of APC; CDC26 is involved in cell cycle progression, regulates accumulation of the APC/C target proteins and controls cell division, growth, and embryo development

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ANAPC_CDC26 pfam10471
Anaphase-promoting complex APC subunit CDC26; The anaphase-promoting complex (APC) or ...
1-64 3.40e-08

Anaphase-promoting complex APC subunit CDC26; The anaphase-promoting complex (APC) or cyclosome is a cell cycle-regulated ubiquitin-protein ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins thereby targeting them for proteolysis by the 26S proteasome. CDC26 is one of the nine or so subunits identified within APC but its exact function is not known. The APC/C becomes active at the metaphase/anaphase transition and remains active during G1 phase. One mechanism linked to activation of the APC/C is phosphorylation. The yeast APC/C is composed of at least 13 subunits, but the function of many of the subunits is unknown. Hcn1 is the smallest subunit of the S. pombe APC/C, and is found to be essential for cell viability, APC/C integrity, and proper APC/C regulation. In addition, Hcn1 phosphorylation indicates a specific role for the phosphorylation of this subunit late in the cell cycle.


:

Pssm-ID: 402205  Cd Length: 65  Bit Score: 45.47  E-value: 3.40e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 21314828    1 MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVgTSDGEGAAGLSSDPKSREQMINDR 64
Cdd:pfam10471  1 MLRRKPTTITLTSEDIAEYEDSRQRQQQQAAQLQRNQAS-ASTSSGSDTSTDDFTSNTIDPNDE 63
 
Name Accession Description Interval E-value
ANAPC_CDC26 pfam10471
Anaphase-promoting complex APC subunit CDC26; The anaphase-promoting complex (APC) or ...
1-64 3.40e-08

Anaphase-promoting complex APC subunit CDC26; The anaphase-promoting complex (APC) or cyclosome is a cell cycle-regulated ubiquitin-protein ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins thereby targeting them for proteolysis by the 26S proteasome. CDC26 is one of the nine or so subunits identified within APC but its exact function is not known. The APC/C becomes active at the metaphase/anaphase transition and remains active during G1 phase. One mechanism linked to activation of the APC/C is phosphorylation. The yeast APC/C is composed of at least 13 subunits, but the function of many of the subunits is unknown. Hcn1 is the smallest subunit of the S. pombe APC/C, and is found to be essential for cell viability, APC/C integrity, and proper APC/C regulation. In addition, Hcn1 phosphorylation indicates a specific role for the phosphorylation of this subunit late in the cell cycle.


Pssm-ID: 402205  Cd Length: 65  Bit Score: 45.47  E-value: 3.40e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 21314828    1 MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVgTSDGEGAAGLSSDPKSREQMINDR 64
Cdd:pfam10471  1 MLRRKPTTITLTSEDIAEYEDSRQRQQQQAAQLQRNQAS-ASTSSGSDTSTDDFTSNTIDPNDE 63
 
Name Accession Description Interval E-value
ANAPC_CDC26 pfam10471
Anaphase-promoting complex APC subunit CDC26; The anaphase-promoting complex (APC) or ...
1-64 3.40e-08

Anaphase-promoting complex APC subunit CDC26; The anaphase-promoting complex (APC) or cyclosome is a cell cycle-regulated ubiquitin-protein ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins thereby targeting them for proteolysis by the 26S proteasome. CDC26 is one of the nine or so subunits identified within APC but its exact function is not known. The APC/C becomes active at the metaphase/anaphase transition and remains active during G1 phase. One mechanism linked to activation of the APC/C is phosphorylation. The yeast APC/C is composed of at least 13 subunits, but the function of many of the subunits is unknown. Hcn1 is the smallest subunit of the S. pombe APC/C, and is found to be essential for cell viability, APC/C integrity, and proper APC/C regulation. In addition, Hcn1 phosphorylation indicates a specific role for the phosphorylation of this subunit late in the cell cycle.


Pssm-ID: 402205  Cd Length: 65  Bit Score: 45.47  E-value: 3.40e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 21314828    1 MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVgTSDGEGAAGLSSDPKSREQMINDR 64
Cdd:pfam10471  1 MLRRKPTTITLTSEDIAEYEDSRQRQQQQAAQLQRNQAS-ASTSSGSDTSTDDFTSNTIDPNDE 63
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH