NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|21704136|ref|NP_663540|]
View 

L-serine dehydratase/L-threonine deaminase [Mus musculus]

Protein Classification

serine/threonine dehydratase family protein (domain architecture ID 10157824)

serine/threonine dehydratase family protein such as L-serine dehydratase/L-threonine deaminase, a pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes dehydration of L-Ser/Thr to yield pyruvate/ketobutyrate and ammonia

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
10-320 4.10e-157

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


:

Pssm-ID: 107209  Cd Length: 316  Bit Score: 442.12  E-value: 4.10e-157
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQG---CRHFVCSSAGNAGMATAYAARRLGIPATIV 86
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  87 VPNTTPALTIERLKNEGATVEVVGEML-DEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL--SAKPGAI 163
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLqsQEKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 164 VLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFS 243
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21704136 244 EVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgRLQTPLASLVVIVCGGSNISLAQLQALKVQL 320
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
10-320 4.10e-157

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 442.12  E-value: 4.10e-157
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQG---CRHFVCSSAGNAGMATAYAARRLGIPATIV 86
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  87 VPNTTPALTIERLKNEGATVEVVGEML-DEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL--SAKPGAI 163
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLqsQEKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 164 VLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFS 243
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21704136 244 EVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgRLQTPLASLVVIVCGGSNISLAQLQALKVQL 320
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
PALP pfam00291
Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate ...
10-304 6.19e-67

Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 395228 [Multi-domain]  Cd Length: 295  Bit Score: 211.78  E-value: 6.19e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCkMKAKQGC--RHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:pfam00291   7 PTPLVRLPRLSKELGVDVYLKLESLNPTGSFKDRGALNLL-LRLKEGEggKTVVEASSGNHGRALAAAAARLGLKCTIVV 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    88 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSV 167
Cdd:pfam00291  86 PEDAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGDPDAVVVPV 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   168 GGGGLLCGVVQGLREvGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGV-NTVGAQTLKLFYEHPIFSEVI 246
Cdd:pfam00291 166 GGGGLIAGIARGLKE-LGPDVRVIGVEPEGAPALARSLAAGRPVPVPVSDTIADGLGVgDEPGALALDLLDEYVGEVVTV 244
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 21704136   247 SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcRLQDEGRLQtPLASLVVIVCG 304
Cdd:pfam00291 245 SDEEALEAMRLLARREGIVVEPSSAAALAAL------KLALAGELK-GGDRVVVVLTG 295
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
2-316 1.18e-58

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 192.05  E-value: 1.18e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQgcRHFVCSSAGNAGMATAY 74
Cdd:COG1171  14 AAAARLKgvvNPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGaynkLSSLSEEEERA--AGVIAASAGNHAQGVAY 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  75 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:COG1171  92 AAKRLGIKATIVMPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILE 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 155 TLSAKPGAIVLSVGGGGLLCGVVQGLREVGWeDVPIIAMETFGAHSFHAAIKEGKL-VTLPKITSVAKALGVNTVGAQTL 233
Cdd:COG1171 171 QLPDLPDAVFVPVGGGGLISGIATALKALSP-EIKVIGVEPEGAPSMYASLKAGKIvVVLPDVGTIADGLAVKRPGDLTF 249
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 234 KLFYEHPifSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgrlqtplaSLVVIVCGGsNISLA 311
Cdd:COG1171 250 EILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIEPLQGK--------TVVVILSGG-NIDFE 318

                ....*
gi 21704136 312 QLQAL 316
Cdd:COG1171 319 RLAEV 323
PRK08198 PRK08198
threonine dehydratase; Provisional
2-322 2.77e-43

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 153.38  E-value: 2.77e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLckmKAKQGCRHFVCSSAGNAGMATAY 74
Cdd:PRK08198  11 EARERLKgvvRRTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIASL---SEEERARGVVAASAGNHAQGVAY 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   75 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:PRK08198  88 AASLLGIKATIVMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  155 TL------------------------SAKPgaivlsvggggllcgvvqglrevgweDVPIIAMETFGAHSFHAAIKEGKL 210
Cdd:PRK08198 167 DLpdvdtvvvpigggglisgvatavkALRP--------------------------EVRVIGVQAEGAPAMPESLAAGRP 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  211 VTLPKITSVAKALGVNTVGAQTLKLFYEHpiFSEVI--SDQEAVSA----LEKfvddEKILVEPACGAALAAVYSRvvcR 284
Cdd:PRK08198 221 VELESVDTIADGIAVKRPGDLTFEIIREL--VDDVVtvSDEEIARAilllLER----AKLVVEGAGAVSVAALLSG---K 291
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 21704136  285 LQDEGRlqtplaSLVVIVCGGsNISLAQLQALkVQLGL 322
Cdd:PRK08198 292 LDVKGK------KVVAVLSGG-NIDVLLLSRV-IERGL 321
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
10-320 4.10e-157

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 442.12  E-value: 4.10e-157
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQG---CRHFVCSSAGNAGMATAYAARRLGIPATIV 86
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  87 VPNTTPALTIERLKNEGATVEVVGEML-DEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL--SAKPGAI 163
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLqsQEKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 164 VLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFS 243
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21704136 244 EVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgRLQTPLASLVVIVCGGSNISLAQLQALKVQL 320
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
PALP pfam00291
Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate ...
10-304 6.19e-67

Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 395228 [Multi-domain]  Cd Length: 295  Bit Score: 211.78  E-value: 6.19e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCkMKAKQGC--RHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:pfam00291   7 PTPLVRLPRLSKELGVDVYLKLESLNPTGSFKDRGALNLL-LRLKEGEggKTVVEASSGNHGRALAAAAARLGLKCTIVV 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    88 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSV 167
Cdd:pfam00291  86 PEDAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGDPDAVVVPV 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   168 GGGGLLCGVVQGLREvGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGV-NTVGAQTLKLFYEHPIFSEVI 246
Cdd:pfam00291 166 GGGGLIAGIARGLKE-LGPDVRVIGVEPEGAPALARSLAAGRPVPVPVSDTIADGLGVgDEPGALALDLLDEYVGEVVTV 244
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 21704136   247 SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcRLQDEGRLQtPLASLVVIVCG 304
Cdd:pfam00291 245 SDEEALEAMRLLARREGIVVEPSSAAALAAL------KLALAGELK-GGDRVVVVLTG 295
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
2-316 1.18e-58

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 192.05  E-value: 1.18e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQgcRHFVCSSAGNAGMATAY 74
Cdd:COG1171  14 AAAARLKgvvNPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGaynkLSSLSEEEERA--AGVIAASAGNHAQGVAY 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  75 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:COG1171  92 AAKRLGIKATIVMPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILE 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 155 TLSAKPGAIVLSVGGGGLLCGVVQGLREVGWeDVPIIAMETFGAHSFHAAIKEGKL-VTLPKITSVAKALGVNTVGAQTL 233
Cdd:COG1171 171 QLPDLPDAVFVPVGGGGLISGIATALKALSP-EIKVIGVEPEGAPSMYASLKAGKIvVVLPDVGTIADGLAVKRPGDLTF 249
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 234 KLFYEHPifSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgrlqtplaSLVVIVCGGsNISLA 311
Cdd:COG1171 250 EILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIEPLQGK--------TVVVILSGG-NIDFE 318

                ....*
gi 21704136 312 QLQAL 316
Cdd:COG1171 319 RLAEV 323
Thr-dehyd cd01562
Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. ...
2-308 3.84e-55

Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly converted into NH4+. The direct deamination is catalyzed by threonine dehydratase, in which pyridoxal phosphate (PLP) is the prosthetic group. Threonine dehydratase is widely distributed in all three major phylogenetic divisions.


Pssm-ID: 107205  Cd Length: 304  Bit Score: 181.53  E-value: 3.84e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGcrhFVCSSAGNAGMATAY 74
Cdd:cd01562   6 AAAARIKpvvRRTPLLTSPTLSELLGAEVYLKCENLQKTGSFKIRGaynkLLSLSEEERAKG---VVAASAGNHAQGVAY 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  75 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:cd01562  83 AAKLLGIPATIVMPETAPAAKVDATRAYGAEVVLYGEDFDEAEAKARELAEEE-GLTFIHPFDDPDVIAGQGTIGLEILE 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 155 TLsAKPGAIvlsvggggllcgvvqgLREVG---------------WEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSV 219
Cdd:cd01562 162 QV-PDLDAV----------------FVPVGgggliagiatavkalSPNTKVIGVEPEGAPAMAQSLAAGKPVTLPEVDTI 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 220 AKALGVNTVGAQTLKLFYEHPifSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcrlqDEGRLQTPLAS 297
Cdd:cd01562 225 ADGLAVKRPGELTFEIIRKLV--DDVVtvSEDEIAAAMLLLFEREKLVAEPAGALALAAL---------LSGKLDLKGKK 293
                       330
                ....*....|.
gi 21704136 298 LVVIVCGGsNI 308
Cdd:cd01562 294 VVVVLSGG-NI 303
Trp-synth-beta_II cd00640
Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP) ...
11-305 8.34e-55

Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehyd catalyzes the conversion of L- or D-serine to pyruvate and ammonia. Thr-dehyd is active as a homodimer and catalyzes the conversion of L-threonine to 2-oxobutanoate and ammonia. DAL is also a homodimer and catalyzes the alpha, beta-elimination reaction of both L- and D-alpha, beta-diaminopropionate to form pyruvate and ammonia. Thr-synth catalyzes the formation of threonine and inorganic phosphate from O-phosphohomoserine.


Pssm-ID: 107202 [Multi-domain]  Cd Length: 244  Bit Score: 178.86  E-value: 8.34e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKM---KAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:cd00640   1 TPLVRLKRLSKLGGANIYLKLEFLNPTGSFKDRGALNLILLaeeEGKLPKGVIIESTGGNTGIALAAAAARLGLKCTIVM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  88 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL-SAKPGAIvls 166
Cdd:cd00640  81 PEGASPEKVAQMRALGAEVVLVPGDFDDAIALAKELAEEDPGAYYVNQFDNPANIAGQGTIGLEILEQLgGQKPDAV--- 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 167 vggggllcgvvqglrevgwedvpIIAMETFGAHS-FHAAIKEGKLvtLPKItsvakalgvntVGAQTlklfyehpiFSEV 245
Cdd:cd00640 158 -----------------------VVPVGGGGNIAgIARALKELLP--NVKV-----------IGVEP---------EVVT 192
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 246 ISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcRLQDEGrlqTPLASLVVIVCGG 305
Cdd:cd00640 193 VSDEEALEAIRLLAREEGILVEPSSAAALAAAL-----KLAKKL---GKGKTVVVILTGG 244
PRK08198 PRK08198
threonine dehydratase; Provisional
2-322 2.77e-43

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 153.38  E-value: 2.77e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLckmKAKQGCRHFVCSSAGNAGMATAY 74
Cdd:PRK08198  11 EARERLKgvvRRTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIASL---SEEERARGVVAASAGNHAQGVAY 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   75 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:PRK08198  88 AASLLGIKATIVMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  155 TL------------------------SAKPgaivlsvggggllcgvvqglrevgweDVPIIAMETFGAHSFHAAIKEGKL 210
Cdd:PRK08198 167 DLpdvdtvvvpigggglisgvatavkALRP--------------------------EVRVIGVQAEGAPAMPESLAAGRP 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  211 VTLPKITSVAKALGVNTVGAQTLKLFYEHpiFSEVI--SDQEAVSA----LEKfvddEKILVEPACGAALAAVYSRvvcR 284
Cdd:PRK08198 221 VELESVDTIADGIAVKRPGDLTFEIIREL--VDDVVtvSDEEIARAilllLER----AKLVVEGAGAVSVAALLSG---K 291
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 21704136  285 LQDEGRlqtplaSLVVIVCGGsNISLAQLQALkVQLGL 322
Cdd:PRK08198 292 LDVKGK------KVVAVLSGG-NIDVLLLSRV-IERGL 321
PRK08639 PRK08639
threonine dehydratase; Validated
2-307 1.81e-32

threonine dehydratase; Validated


Pssm-ID: 236318 [Multi-domain]  Cd Length: 420  Bit Score: 124.53  E-value: 1.81e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHL-CKMKAKQGCRHFVCSSAGNAGMATAYAAR 77
Cdd:PRK08639  14 KAAKRLKdvvPETPLQRNDYLSEKYGANVYLKREDLQPVRSYKLRGAYNAiSQLSDEELAAGVVCASAGNHAQGVAYACR 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   78 RLGIPATIVVPNTTPALTIERLK---NEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:PRK08639  94 HLGIPGVIFMPVTTPQQKIDQVRffgGEFVEIVLVGDTFDDSAAAAQEYAEET-GATFIPPFDDPDVIAGQGTVAVEILE 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  155 TLS--AKPGAIVLSVGGGGLLCGVVQGLREVGWEdVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQT 232
Cdd:PRK08639 173 QLEkeGSPDYVFVPVGGGGLISGVTTYLKERSPK-TKIIGVEPAGAASMKAALEAGKPVTLEKIDKFVDGAAVARVGDLT 251
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 21704136  233 LKLFYEHPifSEVIS-DQEAVSA--LEKFvDDEKILVEPACGAALAAVysrvvcrlqDEGRLQTPLASLVVIVCGGSN 307
Cdd:PRK08639 252 FEILKDVV--DDVVLvPEGAVCTtiLELY-NKEGIVAEPAGALSIAAL---------ELYKDEIKGKTVVCVISGGNN 317
PRK12483 PRK12483
threonine dehydratase; Reviewed
9-321 2.48e-32

threonine dehydratase; Reviewed


Pssm-ID: 237111 [Multi-domain]  Cd Length: 521  Bit Score: 125.68  E-value: 2.48e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    9 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGI-GHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:PRK12483  36 RETPLQRAPNLSARLGNQVLLKREDLQPVFSFKIRGAyNKMARLPAEQLARGVITASAGNHAQGVALAAARLGVKAVIVM 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   88 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELketLSAKPGAIVLS- 166
Cdd:PRK12483 116 PRTTPQLKVDGVRAHGGEVVLHGESFPDALAHALKLAEEE-GLTFVPPFDDPDVIAGQGTVAMEI---LRQHPGPLDAIf 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  167 -----VGGGGLLCGVVQGLRevgwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHpi 241
Cdd:PRK12483 192 vpvggGGLIAGIAAYVKYVR----PEIKVIGVEPDDSNCLQAALAAGERVVLGQVGLFADGVAVAQIGEHTFELCRHY-- 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  242 FSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVySRVVCRLQDEGRlqtplaSLVVIVcGGSNISLAQLQ--ALK 317
Cdd:PRK12483 266 VDEVVtvSTDELCAAIKDIYDDTRSITEPAGALAVAGI-KKYAEREGIEGQ------TLVAID-SGANVNFDRLRhvAER 337

                 ....
gi 21704136  318 VQLG 321
Cdd:PRK12483 338 AELG 341
PRK09224 PRK09224
threonine ammonia-lyase IlvA;
9-304 1.74e-30

threonine ammonia-lyase IlvA;


Pssm-ID: 236417 [Multi-domain]  Cd Length: 504  Bit Score: 120.24  E-value: 1.74e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    9 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGCrhfVCSSAGNAGMATAYAARRLGIPAT 84
Cdd:PRK09224  19 QETPLEKAPKLSARLGNQVLLKREDLQPVFSFKLRGaynkMAQLTEEQLARGV---ITASAGNHAQGVALSAARLGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   85 IVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIV 164
Cdd:PRK09224  96 IVMPVTTPDIKVDAVRAFGGEVVLHGDSFDEAYAHAIELAEEE-GLTFIHPFDDPDVIAGQGTIAMEILQQHPHPLDAVF 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  165 LSvggggllcgvvqglreVG---------------WEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVG 229
Cdd:PRK09224 175 VP----------------VGgggliagvaayikqlRPEIKVIGVEPEDSACLKAALEAGERVDLPQVGLFADGVAVKRIG 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 21704136  230 AQTLKLFYEHpiFSEVIS-DQEAVSALEKFV-DDEKILVEPAcGA-ALAAVySRVVCRLQDEGRlqtplaSLVVIVCG 304
Cdd:PRK09224 239 EETFRLCQEY--VDDVITvDTDEICAAIKDVfEDTRSIAEPA-GAlALAGL-KKYVAQHGIEGE------TLVAILSG 306
PRK07334 PRK07334
threonine dehydratase; Provisional
1-277 2.42e-30

threonine dehydratase; Provisional


Pssm-ID: 235994 [Multi-domain]  Cd Length: 403  Bit Score: 118.46  E-value: 2.42e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    1 MAAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAA 76
Cdd:PRK07334  11 RAAAARLAgqvLRTPCVHSRTLSQITGAEVWLKFENLQFTASFKERGaLNKLLLLTEEERARGVIAMSAGNHAQGVAYHA 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   77 RRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELketL 156
Cdd:PRK07334  91 QRLGIPATIVMPRFTPTVKVERTRGFGAEVVLHGETLDEARAHARELAEEE-GLTFVHPYDDPAVIAGQGTVALEM---L 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  157 SAKP------------GAIvlsvgggGLLCGVVQGLRevgwEDVPIIAMETFGAHSFHAAIKEgklVTLPKITS-VAKAL 223
Cdd:PRK07334 167 EDAPdldtlvvpigggGLI-------SGMATAAKALK----PDIEIIGVQTELYPSMYAAIKG---VALPCGGStIAEGI 232
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 21704136  224 GVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAV 277
Cdd:PRK07334 233 AVKQPGQLTLEIVRRLVDDILLVSEADIEQAVSLLLEIEKTVVEGAGAAGLAAL 286
PRK08246 PRK08246
serine/threonine dehydratase;
22-305 7.08e-30

serine/threonine dehydratase;


Pssm-ID: 181319  Cd Length: 310  Bit Score: 115.44  E-value: 7.08e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   22 LAGTSVFLKMDSSQPSGSFKIRGIGHLCkMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKN 101
Cdd:PRK08246  34 FGPAPVWLKLEHLQHTGSFKARGAFNRL-LAAPVPAAGVVAASGGNAGLAVAYAAAALGVPATVFVPETAPPAKVARLRA 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  102 EGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLsAKPGAIvlsvggggllcgvvqgLR 181
Cdd:PRK08246 113 LGAEVVVVGAEYADALEAAQAFAAET-GALLCHAYDQPEVLAGAGTLGLEIEEQA-PGVDTV----------------LV 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  182 EVG-----------WED-VPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQ 249
Cdd:PRK08246 175 AVGgggliagiaawFEGrARVVAVEPEGAPTLHAALAAGEPVDVPVSGIAADSLGARRVGEIAFALARAHVVTSVLVSDE 254
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 21704136  250 EAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgrlqtplaSLVVIVCGG 305
Cdd:PRK08246 255 AIIAARRALWEELRLAVEPGAATALAALLSGAYVPAPGE--------RVAVVLCGA 302
PRK06815 PRK06815
threonine/serine dehydratase;
11-315 1.34e-29

threonine/serine dehydratase;


Pssm-ID: 180709  Cd Length: 317  Bit Score: 114.79  E-value: 1.34e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGH-LCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPN 89
Cdd:PRK06815  21 TPLEHSPLLSQHTGCEVYLKCEHLQHTGSFKFRGASNkLRLLNEAQRQQGVITASSGNHGQGVALAAKLAGIPVTVYAPE 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   90 TTPALTIERLKNEGATVEVVG-EMLDEAIQVAKALEKNnpGWVYISPFDDPLIWEGHTSLVKELKETLsAKPGAIVLSVG 168
Cdd:PRK06815 101 QASAIKLDAIRALGAEVRLYGgDALNAELAARRAAEQQ--GKVYISPYNDPQVIAGQGTIGMELVEQQ-PDLDAVFVAVG 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  169 GGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAK--ALGVNTvGAQTLKLFYEHPIFSEVI 246
Cdd:PRK06815 178 GGGLISGIATYLKTLS-PKTEIIGCWPANSPSLYTSLEAGEIVEVAEQPTLSDgtAGGVEP-GAITFPLCQQLIDQKVLV 255
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 21704136  247 SDQEAVSALEKFVDDEKILVEPACGAALAAvYSRVVCRLQdeGRlqtplaSLVVIVCgGSNISLAQLQA 315
Cdd:PRK06815 256 SEEEIKEAMRLIAETDRWLIEGAAGVALAA-ALKLAPRYQ--GK------KVAVVLC-GKNIVLEKYLE 314
eutB PRK07476
threonine dehydratase; Provisional
9-156 6.67e-29

threonine dehydratase; Provisional


Pssm-ID: 236025  Cd Length: 322  Bit Score: 113.14  E-value: 6.67e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    9 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGH-LCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:PRK07476  18 RRTPLVASASLSARAGVPVWLKLETLQPTGSFKLRGATNaLLSLSAQERARGVVTASTGNHGRALAYAARALGIRATICM 97
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 21704136   88 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETL 156
Cdd:PRK07476  98 SRLVPANKVDAIRALGAEVRIVGRSQDDAQAEVERLVREE-GLTMVPPFDDPRIIAGQGTIGLEILEAL 165
PLN02550 PLN02550
threonine dehydratase
9-314 1.05e-28

threonine dehydratase


Pssm-ID: 178165 [Multi-domain]  Cd Length: 591  Bit Score: 116.17  E-value: 1.05e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    9 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGI-GHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:PLN02550 108 IESPLQLAKKLSERLGVKVLLKREDLQPVFSFKLRGAyNMMAKLPKEQLDKGVICSSAGNHAQGVALSAQRLGCDAVIAM 187
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   88 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSV 167
Cdd:PLN02550 188 PVTTPEIKWQSVERLGATVVLVGDSYDEAQAYAKQRALEE-GRTFIPPFDHPDVIAGQGTVGMEIVRQHQGPLHAIFVPV 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  168 GGGGLLCGVVQGLREVGWEdVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVIS 247
Cdd:PLN02550 267 GGGGLIAGIAAYVKRVRPE-VKIIGVEPSDANAMALSLHHGERVMLDQVGGFADGVAVKEVGEETFRLCRELVDGVVLVS 345
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  248 DQEAVSALEKFVDDEKILVEPACGAALAAvySRVVCR---LQDEGrlqtplaslVVIVCGGSNISLAQLQ 314
Cdd:PLN02550 346 RDAICASIKDMFEEKRSILEPAGALALAG--AEAYCKyygLKDEN---------VVAITSGANMNFDRLR 404
PRK08526 PRK08526
threonine dehydratase; Provisional
9-313 6.40e-27

threonine dehydratase; Provisional


Pssm-ID: 181457 [Multi-domain]  Cd Length: 403  Bit Score: 109.03  E-value: 6.40e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    9 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGCrhfVCSSAGNAGMATAYAARRLGIPAT 84
Cdd:PRK08526  19 NKTPFAYAPFLSKISGAEVYLKKENLQITGAYKIRGaynkIANLSEEQKQHGV---IAASAGNHAQGVAISAKKFGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   85 IVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSaKPGAIV 164
Cdd:PRK08526  96 IVMPEATPLLKVSGTKALGAEVILKGDNYDEAYAFALEYAKEN-NLTFIHPFEDEEVMAGQGTIALEMLDEIS-DLDMVV 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  165 LSVGGGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEhpIFSE 244
Cdd:PRK08526 174 VPVGGGGLISGIASAAKQIN-PNIKIIGVGAKGAPAMYESFHAKKIINSKSVRTIADGIAVRDASPINLAIILE--CVDD 250
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 21704136  245 VIS--DQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcrlqdEGRLQTPLASLVVIVCGGSNISLAQL 313
Cdd:PRK08526 251 FVQvdDEEIANAILFLLEKQKIVVEGAGAASVAALL---------HQKIDLKKGKKIGVVLSGGNIDVQML 312
Thr-synth_1 cd01563
Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last ...
11-304 1.05e-26

Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate. It proceeds by converting O-phospho-L-homoserine (OPH) into threonine and inorganic phosphate. In plants, OPH is an intermediate between the methionine and threonine/isoleucine pathways. Thus threonine synthase competes for OPH with cystathionine-gamma-synthase, the first enzyme in the methionine pathway. These enzymes are in general dimers. Members of this CD, Thr-synth_1, are widely distributed in bacteria, archaea and higher plants.


Pssm-ID: 107206  Cd Length: 324  Bit Score: 107.29  E-value: 1.05e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  11 TPLRDSMALSK-LAGTSVFLKMDSSQPSGSFKIRGighlckM-----KAKQ-GCRHFVCSSAGNAGMATAYAARRLGIPA 83
Cdd:cd01563  23 TPLVRAPRLGErLGGKNLYVKDEGLNPTGSFKDRG------MtvavsKAKElGVKAVACASTGNTSASLAAYAARAGIKC 96
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  84 TIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpgWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGA 162
Cdd:cd01563  97 VVFLPAGKALGKLAQALAYGATVLAVEGNFDDALRLVRELAEEN--WIYLSNSLNPYRLEGQKTIAFEIAEQLGWEvPDY 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 163 IVLSVGGGGLLCGVVQG---LREVGW-EDVP-IIAMETFGAHSFHAAIKEGKLVTLP--KITSVAKALGV-NTVGA-QTL 233
Cdd:cd01563 175 VVVPVGNGGNITAIWKGfkeLKELGLiDRLPrMVGVQAEGAAPIVRAFKEGKDDIEPveNPETIATAIRIgNPASGpKAL 254
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 21704136 234 KLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcRLQDEGRLQTPlASLVVIVCG 304
Cdd:cd01563 255 RAVRESGGTAVAVSDEEILEAQKLLARTEGIFVEPASAASLAGLK-----KLREEGIIDKG-ERVVVVLTG 319
PLN02970 PLN02970
serine racemase
10-313 1.12e-24

serine racemase


Pssm-ID: 215524  Cd Length: 328  Bit Score: 101.68  E-value: 1.12e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGCrhfVCSSAGNAGMATAYAARRLGIPATI 85
Cdd:PLN02970  27 RTPVLTSSSLDALAGRSLFFKCECFQKGGAFKFRGacnaIFSLSDDQAEKGV---VTHSSGNHAAALALAAKLRGIPAYI 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   86 VVPNTTPALTIERLKNEGATVeVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLsakPG--AI 163
Cdd:PLN02970 104 VVPKNAPACKVDAVIRYGGII-TWCEPTVESREAVAARVQQETGAVLIHPYNDGRVISGQGTIALEFLEQV---PEldVI 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  164 VLSVGGGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVnTVGAQTLklfyehPIFS 243
Cdd:PLN02970 180 IVPISGGGLISGIALAAKAIK-PSIKIIAAEPKGADDAAQSKAAGEIITLPVTNTIADGLRA-SLGDLTW------PVVR 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  244 E------VISDQEAVSALEKFVDDEKILVEPACGAALAAVYSrvvcrlqdEGRLQTPLAS----LVVIVCGGsNISLAQL 313
Cdd:PLN02970 252 DlvddviTVDDKEIIEAMKLCYERLKVVVEPSGAIGLAAALS--------DSFRSNPAWKgcknVGIVLSGG-NVDLGVL 322
PRK06608 PRK06608
serine/threonine dehydratase;
10-316 1.73e-24

serine/threonine dehydratase;


Pssm-ID: 235842  Cd Length: 338  Bit Score: 101.39  E-value: 1.73e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGI-GHLCKMKaKQGCR--HFVCSSAGNAGMATAYAARRLGIPATIV 86
Cdd:PRK06608  23 LTPIVHSESLNEMLGHEIFFKVESLQKTGAFKVRGVlNHLLELK-EQGKLpdKIVAYSTGNHGQAVAYASKLFGIKTRIY 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   87 VPNTTPALTIERLKNEGATVEVVgEMLDEAIQvaKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLS 166
Cdd:PRK06608 102 LPLNTSKVKQQAALYYGGEVILT-NTRQEAEE--KAKEDEEQGFYYIHPSDSDSTIAGAGTLCYEALQQLGFSPDAIFAS 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  167 VGGGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKI-TSVAKALGVNTVGAQTLKL------FYEH 239
Cdd:PRK06608 179 CGGGGLISGTYLAKELIS-PTSLLIGSEPLNANDAYLSLKNNKIYRLNYSpNTIADGLKTLSVSARTFEYlkklddFYLV 257
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 21704136  240 PIFSEVISDQEAVSALekfvddeKILVEPACGAALAAVYSRVvcrlqdegRLQTPLASLVVIVCGGsNISLAQLQAL 316
Cdd:PRK06608 258 EEYEIYYWTAWLTHLL-------KVICEPSSAINMVAVVNWL--------KTQSKPQKLLVILSGG-NIDPILYNEL 318
PRK06382 PRK06382
threonine dehydratase; Provisional
10-309 3.80e-21

threonine dehydratase; Provisional


Pssm-ID: 180550 [Multi-domain]  Cd Length: 406  Bit Score: 93.03  E-value: 3.80e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVP 88
Cdd:PRK06382  25 RTPLIHSTTFGDEYGGDIYFKLENFQKTGSFKSRGaVFKFSKLSEDELRNGVITASAGNHAQGVAYAASINGIDAKIVMP 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   89 -NTTPAlTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLS---------A 158
Cdd:PRK06382 105 eYTIPQ-KVNAVEAYGAHVILTGRDYDEAHRYADKIAMDE-NRTFIEAFNDRWVISGQGTIGLEIMEDLPdldqiivpvG 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  159 KPGAIVLSVGGGGLLCgvvqglrevgwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYE 238
Cdd:PRK06382 183 GGGLISGIALAAKHIN-----------PNVKIIGIESELSDSMKASLREGKIVAHTSGVSICDGISVKYPGDLTFDIAKN 251
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 21704136  239 HPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcrlqdEGRLQTPLASLVVIVCGGsNIS 309
Cdd:PRK06382 252 YVDDIVTVTEESVSKAIYKLFEREKIVAEPSGAVGLAAIM---------EGKVDVKGKKVAIVVSGG-NIN 312
PRK08638 PRK08638
bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;
2-156 9.19e-21

bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;


Pssm-ID: 236317  Cd Length: 333  Bit Score: 90.95  E-value: 9.19e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    2 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGcrhFVCSSAGNAGMATAY 74
Cdd:PRK08638  16 EAKQRLAgriRKTPLPRSNYLSERCKGEIFLKLENMQRTGSFKIRGafnkLSSLTDAEKRKG---VVACSAGNHAQGVAL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   75 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 154
Cdd:PRK08638  93 SCALLGIDGKVVMPKGAPKSKVAATCGYGAEVVLHGDNFNDTIAKVEEIVEEE-GRTFIPPYDDPKVIAGQGTIGLEILE 171

                 ..
gi 21704136  155 TL 156
Cdd:PRK08638 172 DL 173
PRK08813 PRK08813
threonine dehydratase; Provisional
27-276 4.93e-20

threonine dehydratase; Provisional


Pssm-ID: 236339  Cd Length: 349  Bit Score: 89.30  E-value: 4.93e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   27 VFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEGAT 105
Cdd:PRK08813  50 VWLKLENLQRTGSYKVRGaLNALLAGLERGDERPVICASAGNHAQGVAWSAYRLGVQAITVMPHGAPQTKIAGVAHWGAT 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  106 VEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKetlSAKPGAIVLSVGGGGLLCGVVQGLREVGw 185
Cdd:PRK08813 130 VRQHGNSYDEAYAFARELADQN-GYRFLSAFDDPDVIAGQGTVGIELA---AHAPDVVIVPIGGGGLASGVALALKSQG- 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  186 edVPIIAMETFGAHSFHAAIKeGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKIL 265
Cdd:PRK08813 205 --VRVVGAQVEGVDSMARAIR-GDLREIAPVATLADGVKVKIPGFLTRRLCSSLLDDVVIVREAELRETLVRLALEEHVI 281
                        250
                 ....*....|.
gi 21704136  266 VEPACGAALAA 276
Cdd:PRK08813 282 AEGAGALALAA 292
PRK08197 PRK08197
threonine synthase; Validated
11-304 9.19e-19

threonine synthase; Validated


Pssm-ID: 181283 [Multi-domain]  Cd Length: 394  Bit Score: 85.82  E-value: 9.19e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSK-LAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMA-TAYAArRLGIPATIVVP 88
Cdd:PRK08197  80 TPLLPLPRLGKaLGIGRLWVKDEGLNPTGSFKARGLAVGVSRAKELGVKHLAMPTNGNAGAAwAAYAA-RAGIRATIFMP 158
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   89 NTTPALTIERLKNEGATVEVV-GEMLDEAIQVAKALEKNnpGWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGAIVLS 166
Cdd:PRK08197 159 ADAPEITRLECALAGAELYLVdGLISDAGKIVAEAVAEY--GWFDVSTLKEPYRIEGKKTMGLELAEQLGWRlPDVILYP 236
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  167 VGGGGLLCGVVQGLRE---VGW--EDVP-IIAMETFG----AHSFHAAIKEGKL----VTLPKITSVAKALGVNTVgaqt 232
Cdd:PRK08197 237 TGGGVGLIGIWKAFDEleaLGWigGKRPrLVAVQAEGcapiVKAWEEGKEESEFwedaHTVAFGIRVPKALGDFLV---- 312
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 21704136  233 LKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcRLQDEGRLQtPLASLVVIVCG 304
Cdd:PRK08197 313 LDAVRETGGCAIAVSDDAILAAQRELAREEGLFACPEGAATFAAAR-----QLRESGWLK-GDERVVLFNTG 378
PRK06352 PRK06352
threonine synthase; Validated
11-281 1.01e-18

threonine synthase; Validated


Pssm-ID: 180539  Cd Length: 351  Bit Score: 85.49  E-value: 1.01e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNT 90
Cdd:PRK06352  29 TPLIPLPNLSKELGVTLYGKYEGLNPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   91 TPAL-TIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPgwVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGG 169
Cdd:PRK06352 109 KVALgKLAQAVMYGADIISIQGNFDEALKSVRELAETEA--VTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  170 GGLLCGVVQGLREvgWEDVP---IIAMETFGAHSfHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVI 246
Cdd:PRK06352 187 AGNISAYWKGFKE--WNEAKasgLPRMHGFEAEG-AAAIVQGKPIDNPETIATAIRIGNPASWGLAEAARDESGGYIHSV 263
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 21704136  247 SDQEAVSALEKFVDDEKILVEPACGAALAAVYSRV 281
Cdd:PRK06352 264 TDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHV 298
PRK07048 PRK07048
threo-3-hydroxy-L-aspartate ammonia-lyase;
2-316 5.67e-18

threo-3-hydroxy-L-aspartate ammonia-lyase;


Pssm-ID: 235918  Cd Length: 321  Bit Score: 82.76  E-value: 5.67e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    2 AAQESL----HvKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAA 76
Cdd:PRK07048  13 AAAARLagvaH-RTPVLTSRTADARTGAQVFFKCENFQRMGAFKFRGaYNALSQFSPEQRRAGVVTFSSGNHAQAIALSA 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   77 RRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE-- 154
Cdd:PRK07048  92 RLLGIPATIVMPQDAPAAKVAATRGYGGEVVTYDRYTEDREEIGRRLAEER-GLTLIPPYDHPHVIAGQGTAAKELFEev 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  155 ----TLSAKPGAIVLSVGGGGLLCGVVQGLREVGWEdvPIIAMEtfGAHSFHAaikeGKLVTLPKITSVAKalgvntvGA 230
Cdd:PRK07048 171 gpldALFVCLGGGGLLSGCALAARALSPGCKVYGVE--PEAGND--GQQSFRS----GEIVHIDTPRTIAD-------GA 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  231 QTLKL-FYEHPIFSE------VISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcrlqdEGRLQTPLASLVVIVC 303
Cdd:PRK07048 236 QTQHLgNYTFPIIRRlvddivTVSDAELVDAMRFFAERMKIVVEPTGCLGAAAAL---------RGKVPLKGKRVGVIIS 306
                        330
                 ....*....|...
gi 21704136  304 GGsNISLAQLQAL 316
Cdd:PRK07048 307 GG-NVDLARFAAL 318
PRK05638 PRK05638
threonine synthase; Validated
11-276 2.70e-17

threonine synthase; Validated


Pssm-ID: 235539 [Multi-domain]  Cd Length: 442  Bit Score: 82.17  E-value: 2.70e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLaGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNT 90
Cdd:PRK05638  67 TPLIRARISEKL-GENVYIKDETRNPTGSFRDRLATVAVSYGLPYAANGFIVASDGNAAASVAAYSARAGKEAFVVVPRK 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   91 TPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSakPGAIVLSVGGG 170
Cdd:PRK05638 146 VDKGKLIQMIAFGAKIIRYGESVDEAIEYAEELARLN-GLYNVTPEYNIIGLEGQKTIAFELWEEIN--PTHVIVPTGSG 222
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  171 GLLCGVVQGLREV----GWEDVP-IIAMETFGAHSFHAAIkegklVTLPKITSVAKALGvntvgaqtlkLFYEHPIFSE- 244
Cdd:PRK05638 223 SYLYSIYKGFKELleigVIEEIPkLIAVQTERCNPIASEI-----LGNKTKCNETKALG----------LYVKNPVMKEy 287
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 21704136  245 ------------VISDQEAVSALEKFVDDEKILVEPACGAALAA 276
Cdd:PRK05638 288 vseaikesggtaVVVNEEEIMAGEKLLAKEGIFAELSSAVVMPA 331
CBS_like cd01561
CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS ...
10-290 4.05e-17

CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.


Pssm-ID: 107204  Cd Length: 291  Bit Score: 79.87  E-value: 4.05e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  10 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGC----RHFVCSSAGNAGMATAYAARRLGIPATI 85
Cdd:cd01561   2 NTPLVRLNRLSPGTGAEIYAKLEFFNPGGSVKDRIALYMIEDAEKRGLlkpgTTIIEPTSGNTGIGLAMVAAAKGYRFII 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  86 VVPNTTPALTIERLKNEGATVEVVGEMLDE----AIQVAKALEKNNPGWVYISPFDDPLIWEGH-TSLVKELKETLSAKP 160
Cdd:cd01561  82 VMPETMSEEKRKLLRALGAEVILTPEAEADgmkgAIAKARELAAETPNAFWLNQFENPANPEAHyETTAPEIWEQLDGKV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 161 GAIVLSVGGGGLLCGVVQGLREVgWEDVPIIAMETFGAHSF-----HAAIKEGklvtlpkitsvakaLGVNTVGAqtlkl 235
Cdd:cd01561 162 DAFVAGVGTGGTITGVARYLKEK-NPNVRIVGVDPVGSVLFsggppGPHKIEG--------------IGAGFIPE----- 221
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21704136 236 FYEHPIFSEV--ISDQEAVSALEKFVDDEKILVEPACGAALAAVY---------SRVVCRLQDEGR 290
Cdd:cd01561 222 NLDRSLIDEVvrVSDEEAFAMARRLAREEGLLVGGSSGAAVAAALklakrlgpgKTIVTILPDSGE 287
CysK COG0031
Cysteine synthase [Amino acid transport and metabolism];
11-303 3.84e-15

Cysteine synthase [Amino acid transport and metabolism];


Pssm-ID: 223110  Cd Length: 300  Bit Score: 74.49  E-value: 3.84e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRgIGH------LCKMKAKQGcRHFVCSSAGNAGMATAYAARRLGIPAT 84
Cdd:COG0031  12 TPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDR-IALymiedaEKRGLLKPG-GTIVEATSGNTGIALAMVAAAKGYRLI 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  85 IVVPNTTPALTIERLKNEGATVEVV---GEMLDEAIQVAKALEKNNPGWVYISP-FDDPLIWEGH-TSLVKELKETLSAK 159
Cdd:COG0031  90 IVMPETMSQERRKLLRALGAEVILTpgaPGNMKGAIERAKELAAEIPGYAVWLNqFENPANPEAHyETTGPEIWQQTDGK 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 160 PGAIVLSVGGGGLLCGVVQGLREVgWEDVPIIAMETFGAHSFHAAIKEGKLvtlpkitsvaKALGVNTVgaqTLKLFYEH 239
Cdd:COG0031 170 VDAFVAGVGTGGTITGVARYLKER-NPNVRIVAVDPEGSVLLSGGEGPHKI----------EGIGAGFV---PENLDLDL 235
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 21704136 240 PIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVysRVVCRLQDEGrlqtplASLVVIVC 303
Cdd:COG0031 236 IDEVIRVSDEEAIATARRLAREEGLLVGISSGAALAAA--LKLAKELPAG------KTIVTILP 291
ThrC COG0498
Threonine synthase [Amino acid transport and metabolism];
11-276 6.26e-14

Threonine synthase [Amino acid transport and metabolism];


Pssm-ID: 223572 [Multi-domain]  Cd Length: 411  Bit Score: 71.97  E-value: 6.26e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  11 TPLRDSMALS---KLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:COG0498  77 TPLYKAPALAaplGVLNDNLYVKELGHNPTGSFKDRGMTVLVSLAKELGAKTILCASSGNTGASAAAYAARAGLKVFVLY 156
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  88 PNT-TPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSAK------- 159
Cdd:COG0498 157 PKGkVSPGKLAQMLTLGAHVIAVDGNFDDAQELVKEAANRE-GLLSAVNSINPYRLEGQKTYAFEIAEQLGWKapdhvvv 235
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136 160 P----GAIVLSVGGGGLlcgvvqgLREVGW-EDVP-IIAMETFGAHSFHAAIKEGKLVtlPKITSVAKALGVNTVGAQTL 233
Cdd:COG0498 236 PvgngGNLLAIYKGFKE-------GLPIGKiDKAPnMNGVQAEGFSPGVYAWKEGRET--PETIAPAMDIGNPSNWERAL 306
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 21704136 234 KLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAA 276
Cdd:COG0498 307 FALRESGGLAVAVSDEEILEAIKLLAEREGILIEPHSAVAVAA 349
PRK06721 PRK06721
threonine synthase; Reviewed
11-281 1.79e-12

threonine synthase; Reviewed


Pssm-ID: 136018  Cd Length: 352  Bit Score: 67.02  E-value: 1.79e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNT 90
Cdd:PRK06721  29 TPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   91 TPAL-TIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPgwVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGG 169
Cdd:PRK06721 109 KIAHgKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEP--ITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  170 GGLLCGVVQGL----REVGWEDVPIIAMETFGAhsfhAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEV 245
Cdd:PRK06721 187 AGNITAYWKGFceyeKEKGYKKPRIHGFEAEGA----AAIVKGHVIDEPETIATAIRIGNPASWSYAVEAAEQSHGEIDM 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 21704136  246 ISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRV 281
Cdd:PRK06721 263 VSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHV 298
PRK06110 PRK06110
threonine dehydratase;
19-313 1.85e-10

threonine dehydratase;


Pssm-ID: 235699  Cd Length: 322  Bit Score: 60.78  E-value: 1.85e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   19 LSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQ-GCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTpalTI 96
Cdd:PRK06110  30 LAERLGCEVWVKHENHTPTGAFKVRGgLVYFDRLARRGpRVRGVISATRGNHGQSVAFAARRHGLAATIVVPHGN---SV 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   97 ErlKNE-----GATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFddpliwegHTSLVKELK----ETLSAKP------- 160
Cdd:PRK06110 107 E--KNAamralGAELIEHGEDFQAAREEAARLAAER-GLHMVPSF--------HPDLVRGVAtyalELFRAVPdldvvyv 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  161 ---------GAIVLSvggggllcgvvqglREVGWeDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQ 231
Cdd:PRK06110 176 pigmgsgicGAIAAR--------------DALGL-KTRIVGVVSAHAPAYALSFEAGRVVTTPVATTLADGMACRTPDPE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  232 TLKLFYEHpiFSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcrLQDEGRLQtplASLVVIVCGGSNIS 309
Cdd:PRK06110 241 ALEVIRAG--ADRIVrvTDDEVAAAMRAYFTDTHNVAEGAGAAALAAA-------LQERERLA---GKRVGLVLSGGNID 308

                 ....
gi 21704136  310 LAQL 313
Cdd:PRK06110 309 RAVF 312
PRK07409 PRK07409
threonine synthase; Validated
11-89 2.03e-10

threonine synthase; Validated


Pssm-ID: 236013  Cd Length: 353  Bit Score: 60.98  E-value: 2.03e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGighlckM-----KAK-QGCRHFVCSSAGN-AGMATAYAArRLGIPA 83
Cdd:PRK07409  32 TPLIPAPNLSELLGVEVYVKYEGLNPTGSFKDRG------MtmavtKAKeEGAKAVICASTGNtSASAAAYAA-RAGLKA 104

                 ....*.
gi 21704136   84 TIVVPN 89
Cdd:PRK07409 105 FVLIPE 110
PRK06450 PRK06450
threonine synthase; Validated
24-276 2.85e-10

threonine synthase; Validated


Pssm-ID: 180565 [Multi-domain]  Cd Length: 338  Bit Score: 60.52  E-value: 2.85e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   24 GTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEG 103
Cdd:PRK06450  64 KGNIWFKLDFLNPTGSYKDRGSVTLISYLAEKGIKQISEDSSGNAGASIAAYGAAAGIEVKIFVPETASGGKLKQIESYG 143
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  104 ATVEVVGEMLDEaiqVAKALEknNPGWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGAIVLSVGGGGLLCGVVQGLR- 181
Cdd:PRK06450 144 AEVVRVRGSRED---VAKAAE--NSGYYYASHVLQPQFRDGIRTLAYEIAKDLDWKiPNYVFIPVSAGTLLLGVYSGFKh 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  182 --EVG-WEDVP-IIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALgvntVGAQTLKLFYEHPIFSE-----VISDQEAV 252
Cdd:PRK06450 219 llDSGvISEMPkIVAVQTEQVSPLCAKFKGISYTPPDKVTSIADAL----VSTRPFLLDYMVKALSEygeciVVSDNEIV 294
                        250       260
                 ....*....|....*....|....
gi 21704136  253 SAlEKFVDDEKILVEPACGAALAA 276
Cdd:PRK06450 295 EA-WKELAKKGLLVEYSSATVYAA 317
PRK08329 PRK08329
threonine synthase; Validated
24-310 6.45e-09

threonine synthase; Validated


Pssm-ID: 236244 [Multi-domain]  Cd Length: 347  Bit Score: 56.37  E-value: 6.45e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   24 GTSVFLKMDSSQPSGSFKIRGIG-HLCKMKaKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNE 102
Cdd:PRK08329  71 SIKVYFKLDYLQPTGSFKDRGTYvTVAKLK-EEGINEVVIDSSGNAALSLALYSLSEGIKVHVFVSYNASKEKISLLSRL 149
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  103 GATVEVVG----EMLDEAIQVAKaleknNPGWVYISPFDDPLIWEGHTSLVKELKETLSAkPGAIVLSVGGGGLLCGVVQ 178
Cdd:PRK08329 150 GAELHFVEgdrmEVHEEAVKFSK-----RNNIPYVSHWLNPYFLEGTKTIAYEIYEQIGV-PDYAFVPVGSGTLFLGIWK 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  179 G---LREVG-WEDVP-IIAMETFGAHSF-HAAIKEGKLVTLPKITSVAKAlgvntvgAQTLKLFYEHPIFSEVISDQEAV 252
Cdd:PRK08329 224 GfkeLHEMGeISKMPkLVAVQAEGYESLcKRSKSENKLADGIAIPEPPRK-------EEMLRALEESNGFCISVGEEETR 296
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 21704136  253 SALEKFVdDEKILVEPACGAALAAVYSrvvcrLQDEGRLQTplASLVVIVCGGSNISL 310
Cdd:PRK08329 297 AALHWLR-RMGFLVEPTSAVALAAYWK-----LLEEGLIEG--GSKVLLPLSGSGLKN 346
PRK08206 PRK08206
diaminopropionate ammonia-lyase; Provisional
8-134 1.60e-07

diaminopropionate ammonia-lyase; Provisional


Pssm-ID: 236186  Cd Length: 399  Bit Score: 52.19  E-value: 1.60e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136    8 HVKTPLRDSMALSKLAGT-SVFLKmDSSQPSG--SFKIRG-----IGHLCKM------------------KAKQGCRHFV 61
Cdd:PRK08206  42 YAPTPLVALPDLAAELGVgSILVK-DESYRFGlnAFKALGgayavARLLAEKlgldiselsfeeltsgevREKLGDITFA 120
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21704136   62 CSSAGNAGMATAYAARRLGIPATIVVPNTTpalTIERLKN---EGATVEVVGEMLDEAIQVAKALEKNNpGWVYIS 134
Cdd:PRK08206 121 TATDGNHGRGVAWAAQQLGQKAVIYMPKGS---SEERVDAiraLGAECIITDGNYDDSVRLAAQEAQEN-GWVVVQ 192
PRK06381 PRK06381
threonine synthase; Validated
11-163 6.41e-07

threonine synthase; Validated


Pssm-ID: 235789  Cd Length: 319  Bit Score: 50.09  E-value: 6.41e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAGTS-VFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPN 89
Cdd:PRK06381  16 TPLLRARKLEEELGLRkIYLKFEGANPTGTQKDRIAEAHVRRAMRLGYSGITVGTCGNYGASIAYFARLYGLKAVIFIPR 95
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21704136   90 TTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFD--DPLIWEGHTSLVKELKETLSAKPGAI 163
Cdd:PRK06381  96 SYSNSRVKEMEKYGAEIIYVDGKYEEAVERSRKFAKEN-GIYDANPGSvnSVVDIEAYSAIAYEIYEALGDVPDAV 170
PRK07591 PRK07591
threonine synthase; Validated
11-304 4.22e-06

threonine synthase; Validated


Pssm-ID: 236065 [Multi-domain]  Cd Length: 421  Bit Score: 48.03  E-value: 4.22e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAG-TSVFLKMDSSQPSGSFKIRGIGhLCKMKAKQ-GCRHFVCSSAGNAGMATAYAARRLGIPATIVVP 88
Cdd:PRK07591  90 TPLVKADRLARELGlKNLYIKDDSVNPTHSFKDRVVS-VALTAARElGFTTVACASTGNLANSVAAHAARAGLDSCVFIP 168
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   89 -NTTPALTIERLKNEGATVEVVGEMlDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGAIVLS 166
Cdd:PRK07591 169 aDLEAGKIVGTLVYGPTLVAVDGNY-DDVNRLCSELANEHEGWGFVNINLRPYYAEGSKTLGYEVAEQLGWRlPDQVVAP 247
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  167 VGGGGLLCGVVQGLRE---VGW-EDVPIiamETFGAHS-----FHAAIKEGKLVTLP-KITSVAK--ALGVNTVGAQTLK 234
Cdd:PRK07591 248 LASGSLLTKIDKGFQElikVGLvEDKPV---RVFGAQAegcspIAQAFKEGRDVVKPvKPNTIAKslAIGNPADGPYALD 324
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  235 LFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAavysrVVCRLQDEGRLQtPLASLVVIVCG 304
Cdd:PRK07591 325 IARRTGGAIEDVTDEEIIEGIKLLARTEGIFTETAGGVTVA-----VLKKLVEAGKID-PDEETVVYITG 388
PRK06260 PRK06260
threonine synthase; Validated
11-276 9.70e-06

threonine synthase; Validated


Pssm-ID: 235757 [Multi-domain]  Cd Length: 397  Bit Score: 46.85  E-value: 9.70e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAG-TSVFLKMDSSQPSGSFKIRGighlckM-----KAKQ-GCRHFVCSSAGN--AGMAtAYAARRlGI 81
Cdd:PRK06260  68 TPLYRCPNLEKELGvKELYVKHEGANPTGSFKDRG------MtvgvtKALElGVKTVACASTGNtsASLA-AYAARA-GL 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   82 PATIVVPNTTPAL-TIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPgwVY----ISPFD------------DPLIWE- 143
Cdd:PRK06260 140 KCYVLLPAGKVALgKLAQALLHGAKVLEVDGNFDDALDMVVELAKEGK--IYllnsINPFRlegqktigfeiaDQLGWEv 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136  144 -----------GHTSLV----KELKETlsakpGAIvlsvggggllcgvvqglrevgwEDVP-IIAMETFGAHSFHAAIKE 207
Cdd:PRK06260 218 pdrvvlpvgnaGNISAIwkgfKELVEL-----GII----------------------DKLPkMTGIQAEGAAPIVEAIKK 270
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 21704136  208 GKLVTLP--KITSVAKAL----GVNTVGAqtLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAA 276
Cdd:PRK06260 271 GKDEIEPveNPETVATAIrignPVNAPKA--LRAIRESGGTAEAVSDEEILDAQKLLARKEGIGVEPASAASVAG 343
PLN02569 PLN02569
threonine synthase
36-106 2.58e-03

threonine synthase


Pssm-ID: 178182 [Multi-domain]  Cd Length: 484  Bit Score: 39.41  E-value: 2.58e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 21704136   36 PSGSFKIRGIGHLCKM-----KAKQGCRHFVCSSAGNAGMA-TAYAARrLGIPATIVVPNTTPALT--IERLKNeGATV 106
Cdd:PLN02569 161 HTGSFKDLGMTVLVSQvnrlrKMAKPVVGVGCASTGDTSAAlSAYCAA-AGIPSIVFLPADKISIAqlVQPIAN-GALV 237
PRK13803 PRK13803
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional
11-120 2.73e-03

bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional


Pssm-ID: 237513 [Multi-domain]  Cd Length: 610  Bit Score: 39.41  E-value: 2.73e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21704136   11 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIR---GIGHLCKMKAKQgcRHFVCSSAGNAGMATAYAARRLGIPATIVV 87
Cdd:PRK13803 272 TPLTEAKRLSDIYGARIYLKREDLNHTGSHKINnalGQALLAKRMGKT--RIIAETGAGQHGVATATACALFGLKCTIFM 349
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 21704136   88 PNTT---PALTIERLKNEGATVEVV---GEMLDEAIQVA 120
Cdd:PRK13803 350 GEEDikrQALNVERMKLLGANVIPVlsgSKTLKDAVNEA 388
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH