NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|22122799|ref|NP_666343|]
View 

zinc finger protein 124 isoform 2 [Mus musculus]

Protein Classification

KRAB domain-containing zinc finger protein (domain architecture ID 12016853)

KRAB (Kruppel-associated box) domain-containing zinc finger protein (KRAB-ZFP) plays important roles in cell differentiation and organ development and in regulating viral replication and transcription

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
4-44 7.14e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


:

Pssm-ID: 396083  Cd Length: 42  Bit Score: 80.14  E-value: 7.14e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 22122799     4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG 44
Cdd:pfam01352   2 VTFEDVAVDFTQEEWELLDPAQRELYRDVMLENYRNLVSLG 42
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
101-253 1.67e-08

FOG: Zn-finger [General function prediction only];


:

Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 54.70  E-value: 1.67e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 101 KPYECNQCGKAFSQHSRLQYHKRS--HTGE--KPYKC--NQCGKAYGHHSSLQYHKRRHTGEKPYHC--NQCDKAFS--- 169
Cdd:COG5048 288 LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCpySLCGKLFSRNDALKRHILLHTSISPAKEklLNSSSKFSpll 367
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 170 --EHSSLEYHKITHLGEKPYECD--QCGKAFAWQSSLNIHKRTHSGEKPYECN--ECGKAFTHHASLQSHKRIHTGEKPY 243
Cdd:COG5048 368 nnEPPQSLQQYKDLKNDKKSETLsnSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPL 447
                       170
                ....*....|
gi 22122799 244 QCDQCGKAFA 253
Cdd:COG5048 448 LCSILKSFRR 457
 
Name Accession Description Interval E-value
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
4-44 7.14e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


Pssm-ID: 396083  Cd Length: 42  Bit Score: 80.14  E-value: 7.14e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 22122799     4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG 44
Cdd:pfam01352   2 VTFEDVAVDFTQEEWELLDPAQRELYRDVMLENYRNLVSLG 42
KRAB smart00349
krueppel associated box;
4-46 3.09e-17

krueppel associated box;


Pssm-ID: 214630  Cd Length: 61  Bit Score: 73.78  E-value: 3.09e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 22122799      4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGYK 46
Cdd:smart00349   1 VTFEDVAVYFTQEEWEQLDPAQKNLYRDVMLENYSNLVSLGFQ 43
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
4-41 1.25e-14

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


Pssm-ID: 143639  Cd Length: 40  Bit Score: 66.03  E-value: 1.25e-14
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 22122799   4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNIT 41
Cdd:cd07765   1 VTFEDVAVYFSQEEWELLDPAQRDLYRDVMLENYENLV 38
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
101-253 1.67e-08

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 54.70  E-value: 1.67e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 101 KPYECNQCGKAFSQHSRLQYHKRS--HTGE--KPYKC--NQCGKAYGHHSSLQYHKRRHTGEKPYHC--NQCDKAFS--- 169
Cdd:COG5048 288 LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCpySLCGKLFSRNDALKRHILLHTSISPAKEklLNSSSKFSpll 367
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 170 --EHSSLEYHKITHLGEKPYECD--QCGKAFAWQSSLNIHKRTHSGEKPYECN--ECGKAFTHHASLQSHKRIHTGEKPY 243
Cdd:COG5048 368 nnEPPQSLQQYKDLKNDKKSETLsnSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPL 447
                       170
                ....*....|
gi 22122799 244 QCDQCGKAFA 253
Cdd:COG5048 448 LCSILKSFRR 457
zf-H2C2_2 pfam13465
Zinc-finger double domain;
229-254 1.45e-04

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 38.10  E-value: 1.45e-04
                          10        20
                  ....*....|....*....|....*.
gi 22122799   229 SLQSHKRIHTGEKPYQCDQCGKAFAH 254
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
23-154 3.12e-04

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 41.63  E-value: 3.12e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799  23 PSQKS---LYEEVMLETYQNITaigykwEDHHIEEYcqsSRRHERHERIHIGEKPYERNQCGKAFASDNHLQI----HKR 95
Cdd:COG5189 272 PSQGSaelFEESSLGFDYEFIH------KSVGNKEI---RGGISTGEMIDVRKLPCTNSSSNGKLAHGGERNIdtpsRML 342
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799  96 TNTEEKPYECN--QCGKAFSQHSRLQYHKR---------------SHTG----EKPYKCNQCGKAYGHHSSLQYHKRRHT 154
Cdd:COG5189 343 KVKDGKPYKCPveGCNKKYKNQNGLKYHMLhghqnqklhenpspeKMNIfsakDKPYRCEVCDKRYKNLNGLKYHRKHSH 422
 
Name Accession Description Interval E-value
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
4-44 7.14e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


Pssm-ID: 396083  Cd Length: 42  Bit Score: 80.14  E-value: 7.14e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 22122799     4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG 44
Cdd:pfam01352   2 VTFEDVAVDFTQEEWELLDPAQRELYRDVMLENYRNLVSLG 42
KRAB smart00349
krueppel associated box;
4-46 3.09e-17

krueppel associated box;


Pssm-ID: 214630  Cd Length: 61  Bit Score: 73.78  E-value: 3.09e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 22122799      4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGYK 46
Cdd:smart00349   1 VTFEDVAVYFTQEEWEQLDPAQKNLYRDVMLENYSNLVSLGFQ 43
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
4-41 1.25e-14

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


Pssm-ID: 143639  Cd Length: 40  Bit Score: 66.03  E-value: 1.25e-14
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 22122799   4 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNIT 41
Cdd:cd07765   1 VTFEDVAVYFSQEEWELLDPAQRDLYRDVMLENYENLV 38
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
101-253 1.67e-08

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 54.70  E-value: 1.67e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 101 KPYECNQCGKAFSQHSRLQYHKRS--HTGE--KPYKC--NQCGKAYGHHSSLQYHKRRHTGEKPYHC--NQCDKAFS--- 169
Cdd:COG5048 288 LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCpySLCGKLFSRNDALKRHILLHTSISPAKEklLNSSSKFSpll 367
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 170 --EHSSLEYHKITHLGEKPYECD--QCGKAFAWQSSLNIHKRTHSGEKPYECN--ECGKAFTHHASLQSHKRIHTGEKPY 243
Cdd:COG5048 368 nnEPPQSLQQYKDLKNDKKSETLsnSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPL 447
                       170
                ....*....|
gi 22122799 244 QCDQCGKAFA 253
Cdd:COG5048 448 LCSILKSFRR 457
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
116-210 1.71e-06

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 48.56  E-value: 1.71e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 116 SRLQYHKrshtGEKPYKCN--QCGKAYGHHSSLQYHKrrhtgeKPYHCNQcdkAFSEHSSLEYHKITHLGEKPYECDQCG 193
Cdd:COG5189 339 SRMLKVK----DGKPYKCPveGCNKKYKNQNGLKYHM------LHGHQNQ---KLHENPSPEKMNIFSAKDKPYRCEVCD 405
                        90
                ....*....|....*..
gi 22122799 194 KAFAWQSSLNIHkRTHS 210
Cdd:COG5189 406 KRYKNLNGLKYH-RKHS 421
zf-H2C2_2 pfam13465
Zinc-finger double domain;
229-254 1.45e-04

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 38.10  E-value: 1.45e-04
                          10        20
                  ....*....|....*....|....*.
gi 22122799   229 SLQSHKRIHTGEKPYQCDQCGKAFAH 254
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
23-154 3.12e-04

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 41.63  E-value: 3.12e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799  23 PSQKS---LYEEVMLETYQNITaigykwEDHHIEEYcqsSRRHERHERIHIGEKPYERNQCGKAFASDNHLQI----HKR 95
Cdd:COG5189 272 PSQGSaelFEESSLGFDYEFIH------KSVGNKEI---RGGISTGEMIDVRKLPCTNSSSNGKLAHGGERNIdtpsRML 342
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799  96 TNTEEKPYECN--QCGKAFSQHSRLQYHKR---------------SHTG----EKPYKCNQCGKAYGHHSSLQYHKRRHT 154
Cdd:COG5189 343 KVKDGKPYKCPveGCNKKYKNQNGLKYHMLhghqnqklhenpspeKMNIfsakDKPYRCEVCDKRYKNLNGLKYHRKHSH 422
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
97-274 7.06e-04

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 40.45  E-value: 7.06e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799  97 NTEEKPYECNQCGKAFSQHSRLQYHKRSHTG-EKPYKCNQCGKAYGHHSSLQYHKR--RHTGE--KPYHC--NQCDKAFS 169
Cdd:COG5048 255 SSASESPRSSLPTASSQSSSPNESDSSSEKGfSLPIKSKQCNISFSRSSPLTRHLRsvNHSGEslKPFSCpySLCGKLFS 334
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 170 EHSSLEYHKITHLGEKPYEC--DQCGKAF-----AWQSSLNIHKRTHSGEKPYEC--NECGKAFTHHASLQSHKRIHTGE 240
Cdd:COG5048 335 RNDALKRHILLHTSISPAKEklLNSSSKFspllnNEPPQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSF 414
                       170       180       190
                ....*....|....*....|....*....|....*.
gi 22122799 241 KPYQCD--QCGKAFAHQTSLQCHKRTHTGEKPYECN 274
Cdd:COG5048 415 RPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPLLCS 450
zf-H2C2_2 pfam13465
Zinc-finger double domain;
145-169 7.54e-04

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 36.17  E-value: 7.54e-04
                          10        20
                  ....*....|....*....|....*
gi 22122799   145 SLQYHKRRHTGEKPYHCNQCDKAFS 169
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFK 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
201-226 2.09e-03

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 34.63  E-value: 2.09e-03
                          10        20
                  ....*....|....*....|....*.
gi 22122799   201 SLNIHKRTHSGEKPYECNECGKAFTH 226
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
182-266 2.69e-03

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 38.93  E-value: 2.69e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 182 LGEKPYECD--QCGKAFAWQSSLNIHKRThsgekpyecNECGKAFTHHASLQSHKRIHTGEKPYQCDQCGKAFAHQTSLQ 259
Cdd:COG5189 345 KDGKPYKCPveGCNKKYKNQNGLKYHMLH---------GHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLK 415

                ....*..
gi 22122799 260 CHkRTHT 266
Cdd:COG5189 416 YH-RKHS 421
zf-H2C2_2 pfam13465
Zinc-finger double domain;
117-142 3.07e-03

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 34.25  E-value: 3.07e-03
                          10        20
                  ....*....|....*....|....*.
gi 22122799   117 RLQYHKRSHTGEKPYKCNQCGKAYGH 142
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
101-192 5.30e-03

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 37.75  E-value: 5.30e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22122799 101 KPYECNQCGKAFSQHSRLQYHKRSHTGEKPYKCNQ--CGKAYGHHSSLQYHKRRHTGEKPYhcNQCDKAFSEHSSLEYHK 178
Cdd:COG5048  32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYsgCDKSFSRPLELSRHLRTHHNNPSD--LNSKSLPLSNSKASSSS 109
                        90
                ....*....|....
gi 22122799 179 ITHLGEKPYECDQC 192
Cdd:COG5048 110 LSSSSSNSNDNNLL 123
zf-H2C2_2 pfam13465
Zinc-finger double domain;
173-197 7.58e-03

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 33.09  E-value: 7.58e-03
                          10        20
                  ....*....|....*....|....*
gi 22122799   173 SLEYHKITHLGEKPYECDQCGKAFA 197
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFK 25
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
213-251 8.33e-03

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 37.37  E-value: 8.33e-03
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 22122799 213 KPYECNECGKAFTHHASLQSHKRIHTGEKPYQCDQCGKA 251
Cdd:COG5048  32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCD 70
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH