NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23680960|ref|NP_694795|]
View 

complement C1q-like protein 3 precursor [Mus musculus]

Protein Classification

complement C1q domain-containing protein (domain architecture ID 10448922)

complement C1q domain-containing protein may be involved in the regulation of the inflammatory network

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
C1q pfam00386
C1q domain; C1q is a subunit of the C1 enzyme complex that activates the serum complement ...
128-252 1.26e-50

C1q domain; C1q is a subunit of the C1 enzyme complex that activates the serum complement system.


:

Pssm-ID: 395310  Cd Length: 126  Bit Score: 161.68  E-value: 1.26e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23680960   128 AFYAGLKRQHEGYE--VLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLmrGGDGTSMWADLCKNNQVRASAIAQD 205
Cdd:pfam00386   1 AFSAGRTTGLTAPNeqPVRFDKVLTNIGGHYDPATGKFTCPVPGVYYFSYHIT--TVDGKSLYVSLVKNGQEVVSFYDQP 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 23680960   206 ADQNYDYASNSVVLHLEPGDEVYIKLDGGKA-HGGNNNKYSTFSGFII 252
Cdd:pfam00386  79 QKGSLDVASGSVVLELQRGDEVWLQLTGYNGlYYDGSDTDSTFSGFLL 126
 
Name Accession Description Interval E-value
C1q pfam00386
C1q domain; C1q is a subunit of the C1 enzyme complex that activates the serum complement ...
128-252 1.26e-50

C1q domain; C1q is a subunit of the C1 enzyme complex that activates the serum complement system.


Pssm-ID: 395310  Cd Length: 126  Bit Score: 161.68  E-value: 1.26e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23680960   128 AFYAGLKRQHEGYE--VLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLmrGGDGTSMWADLCKNNQVRASAIAQD 205
Cdd:pfam00386   1 AFSAGRTTGLTAPNeqPVRFDKVLTNIGGHYDPATGKFTCPVPGVYYFSYHIT--TVDGKSLYVSLVKNGQEVVSFYDQP 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 23680960   206 ADQNYDYASNSVVLHLEPGDEVYIKLDGGKA-HGGNNNKYSTFSGFII 252
Cdd:pfam00386  79 QKGSLDVASGSVVLELQRGDEVWLQLTGYNGlYYDGSDTDSTFSGFLL 126
C1Q smart00110
Complement component C1q domain; Globular domain found in many collagens and eponymously in ...
121-255 1.38e-36

Complement component C1q domain; Globular domain found in many collagens and eponymously in complement C1q. When part of full length proteins these domains form a 'bouquet' due to the multimerization of heterotrimers. The C1q fold is similar to that of tumour necrosis factor.


Pssm-ID: 128420  Cd Length: 135  Bit Score: 125.88  E-value: 1.38e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23680960    121 YSTVPKIAFYAGLKRQH-EGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRggdGTSMWADLCKNNQVRA 199
Cdd:smart00110   2 YKAQPRSAFSVIRSNRPpPPGQPIRFDKVLYNQQGHYDPRTGKFTCPVPGVYYFSYHVESK---GRNVKVSLMKNGIQVM 78
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 23680960    200 SAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHG-GNNNKYSTFSGFIIYAD 255
Cdd:smart00110  79 STYDEYQKGLYDVASGGALLQLRQGDQVWLELPDEKNGLyAGEYVDSTFSGFLLFPD 135
 
Name Accession Description Interval E-value
C1q pfam00386
C1q domain; C1q is a subunit of the C1 enzyme complex that activates the serum complement ...
128-252 1.26e-50

C1q domain; C1q is a subunit of the C1 enzyme complex that activates the serum complement system.


Pssm-ID: 395310  Cd Length: 126  Bit Score: 161.68  E-value: 1.26e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23680960   128 AFYAGLKRQHEGYE--VLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLmrGGDGTSMWADLCKNNQVRASAIAQD 205
Cdd:pfam00386   1 AFSAGRTTGLTAPNeqPVRFDKVLTNIGGHYDPATGKFTCPVPGVYYFSYHIT--TVDGKSLYVSLVKNGQEVVSFYDQP 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 23680960   206 ADQNYDYASNSVVLHLEPGDEVYIKLDGGKA-HGGNNNKYSTFSGFII 252
Cdd:pfam00386  79 QKGSLDVASGSVVLELQRGDEVWLQLTGYNGlYYDGSDTDSTFSGFLL 126
C1Q smart00110
Complement component C1q domain; Globular domain found in many collagens and eponymously in ...
121-255 1.38e-36

Complement component C1q domain; Globular domain found in many collagens and eponymously in complement C1q. When part of full length proteins these domains form a 'bouquet' due to the multimerization of heterotrimers. The C1q fold is similar to that of tumour necrosis factor.


Pssm-ID: 128420  Cd Length: 135  Bit Score: 125.88  E-value: 1.38e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23680960    121 YSTVPKIAFYAGLKRQH-EGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRggdGTSMWADLCKNNQVRA 199
Cdd:smart00110   2 YKAQPRSAFSVIRSNRPpPPGQPIRFDKVLYNQQGHYDPRTGKFTCPVPGVYYFSYHVESK---GRNVKVSLMKNGIQVM 78
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 23680960    200 SAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHG-GNNNKYSTFSGFIIYAD 255
Cdd:smart00110  79 STYDEYQKGLYDVASGGALLQLRQGDQVWLELPDEKNGLyAGEYVDSTFSGFLLFPD 135
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH