NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27806769|ref|NP_776402|]
View 

aconitate hydratase, mitochondrial precursor [Bos taurus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
aconitase_mito super family cl36873
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
45-775 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


The actual alignment was detected with superfamily member TIGR01340:

Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1230.51  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    45 YDLLEKNINIVRKRLN-RPLTLSEKIVYGHLDDPAN----QEIE--RGKTYLRLRPDRVAMRDATAQMAMLQFISSGLPK 117
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   118 VAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPN 197
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   198 GGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISC 277
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   278 TGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDH---LVPDSGCHYDQLIEINLSELKPHINGPFT 354
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTGQYSffkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   355 PDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   435 ILRDVGGIVLANACGPCIGQWDRKD-IKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDF 513
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   514 LTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDS-SGQQVDVSPTSQRLQLLEPFDKWDGRDLEDLQILIKVKGKC 592
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSPnPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   593 TTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNaVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSRE 672
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYD-LDGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   673 HAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAP---GKPLTCIIKHPNGTQ 749
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 27806769   750 ETILLNHTFNETQIEWFRAGSALNRM 775
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
45-775 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1230.51  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    45 YDLLEKNINIVRKRLN-RPLTLSEKIVYGHLDDPAN----QEIE--RGKTYLRLRPDRVAMRDATAQMAMLQFISSGLPK 117
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   118 VAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPN 197
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   198 GGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISC 277
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   278 TGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDH---LVPDSGCHYDQLIEINLSELKPHINGPFT 354
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTGQYSffkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   355 PDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   435 ILRDVGGIVLANACGPCIGQWDRKD-IKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDF 513
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   514 LTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDS-SGQQVDVSPTSQRLQLLEPFDKWDGRDLEDLQILIKVKGKC 592
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSPnPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   593 TTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNaVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSRE 672
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYD-LDGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   673 HAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAP---GKPLTCIIKHPNGTQ 749
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 27806769   750 ETILLNHTFNETQIEWFRAGSALNRM 775
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
61-780 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 894.12  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   61 RPLTLSEKIVYGHLDDPanqEIERGKTyLRLRPDRVAMRDATAQMAMLQFISSGLPKVAVPSTI-HCDHlieaqlggekD 139
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  140 LRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAG 219
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  220 IPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  300 NHRMKKYLSKTGRADIAnladefkDHLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGsvaekegwPLDIRV 379
Cdd:PRK07229 227 DERTREFLKAQGREDDW-------VELLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVDQ 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  380 GLIGSCTNSSYEDMGRSAAVAKqalAHGLQCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwdrkD 459
Cdd:PRK07229 292 VLIGSCTNSSYEDLMRAASILK---GKKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM----G 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  460 IKKGEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKfNPETdfLTGKDGKKFKLEAPDadelpraEFDP 539
Cdd:PRK07229 365 QAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRT--LALENGEYPKLEEPE-------GFAV 433
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  540 GQDTYQHPPKDSSGQQVDVSPTSQRLQLLEPFDkwdgrDLEDLQILIKVKGKCTTDHISAAGP-WLKFRGHLDNISNNLL 618
Cdd:PRK07229 434 DDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFVF 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  619 IGAINVENGKAnsvrnavtQEFGPvpdtaryykkhgirWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETN 698
Cdd:PRK07229 509 EGVDNTFPERA--------KEQGG--------------GIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKAN 566
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  699 LKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAPGKPLTCIIKHPNgtqETILLNHTFNETQIEWFRAGSALNRMKEL 778
Cdd:PRK07229 567 LINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKD---EEIEVRHTLSERQIEILLAGGALNLIKKK 643

                 ..
gi 27806769  779 QK 780
Cdd:PRK07229 644 LA 645
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
95-505 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134 [Multi-domain]  Cd Length: 412  Bit Score: 867.52  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  95 RVAMRDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIH 174
Cdd:cd01584   1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 175 QIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGI 254
Cdd:cd01584  81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 255 LTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFK-DHLVPDSGCH 333
Cdd:cd01584 161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKdDLLVADEGAE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 334 YDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQ 413
Cdd:cd01584 241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 414 FTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSP 493
Cdd:cd01584 321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                       410
                ....*....|..
gi 27806769 494 EIVTALAIAGTL 505
Cdd:cd01584 401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
30-777 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 708.33  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  30 AKVAMSHFEPNEYIRYDLLEkninIVRKRLNRPLTLSEKIVYGHLDDPAN------QEIERGK------TYLRLRPDRVA 97
Cdd:COG1048   4 KARKTLTVGGKTYYYYDLPK----LEESGKISKLPYSLKILLENLLRGEDgteehiEALARWLpsgkpeKEIAFRPARVV 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  98 MRDATAQMAmlQFISSGLPKVA-------------VPSTIHCDHLIEAQLGG-----EKDLRRAKDINQEVYNFLATA-G 158
Cdd:COG1048  80 MQDFTGVPA--VVDLAAMRDAMvelggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAaK 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 159 AKYGVGFWRPGSGIIHQIILENYA-----YPGVL----LIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKV 229
Cdd:COG1048 158 AFYNFRVVPPGTGIIHQVNLEYLAkvvwaKPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEV 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 230 IGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSK 309
Cdd:COG1048 238 VGVKLTGKLPEGVTATDLVLTVTGMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRL 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 310 TGRADIAN-LADEFKD-----HLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEK------------- 370
Cdd:COG1048 318 TGRSEEQVaLVEAYAKaqglwYDPADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKilreieikrvysl 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 371 ---EGWPLDIRVGLIGSCTNSSYEDMGRSAA-VAKQALAHGLQCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVL 444
Cdd:COG1048 398 lgkELGDGKVVIAAITSCTNTSNPDVLIAAGlLAKKAVEKGLKVKPwvKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIV 477
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 445 ANACGPCIGQWDR--KDIKKG-EKNTIVT----SYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKFNPETDFL--- 514
Cdd:COG1048 478 GYGCTTCIGNSGPlpEEIEKAiNDNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgtd 556
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 515 -TGKDGKKFKLEAPDADELPRAEFDPGQDTYQHP--------PKDSSGQQVDVSPTSQRLQLLEPFDKWDG---RDLEDL 582
Cdd:COG1048 557 nDGKPVYLKDIWPSTEEIAEAVGKAVKPEMFRKEyadvfkwnAIEVPEGPLYDWPNISTYIRLPPFFDGMGaepKPIKGA 636
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 583 QILIKVKGKCTTDHISAAG--------PWLKFRGHLDNISNNLLIGAINVENGKAN------SVRN---------AVTQE 639
Cdd:COG1048 637 RVLAKLGDSITTDHISPAGsikadspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNemvpgeggyTIHQP 716
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 640 FGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIH 719
Cdd:COG1048 717 SGEIYDAAMKYKEEGIPLVVVAGKNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLG 796
                       810       820       830       840       850       860
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27806769 720 PVDKLTIK--GLKDFAPGKPLTCIIKHPNGTQETI-LLNHTFNETQIEWFRAGSALNRMKE 777
Cdd:COG1048 797 LDGEETIDigGLENLKPGATVTVTVTRGDGPVEEFpVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
67-503 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 334011 [Multi-domain]  Cd Length: 459  Bit Score: 531.21  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    67 EKIVYGHLDDpanqEIERGKTYLrlrPDRVAMRDATAQMAMLQFISSGLPK-----------VAVPSTIHCDHLIEaqlg 135
Cdd:pfam00330   1 EKIWDAHLVE----EEGRGLLYI---PDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDHSIQ---- 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   136 gEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNggglggicigvggADAV 214
Cdd:pfam00330  70 -EKNIEDEISRNKEQYDFLKWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTThgglgalafgvggSEAE 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   215 DVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATT 294
Cdd:pfam00330 149 HVLATQPLEMKKPKVIGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGIRSLSMEGRATICNMAIEYGATA 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   295 SVFPYNHRMKKYLSKTGRADIANLADEFKD----HLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAE- 369
Cdd:pfam00330 229 GLFPPDETTLDYLKATGRPEAPKGEAYDKAvalwTLASDPDAVYDKVVEIDLSTIEPMVTGPTRPDDAVPLSELVPDPDf 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   370 ------------------KEGWPL---DIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKS--QFTITPGSEQIRAT 426
Cdd:pfam00330 309 addlkreaaeraleymglEPGTPLkdgKVDIAFIGSCTNSSIEDLRAAAGLLKKAAEKGLKVAPgvKASVVPGSEVVRAY 388
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27806769   427 IERDGYAQILRDVGGIVLANACGPCIGQWDRKDikkgEKNTIVTSYNRNFTGRNdaNPETHAFVTSPEIVTALAIAG 503
Cdd:pfam00330 389 AEAEGLDKILEEAGFEWRGPGCSMCIGNSDRLP----PGERCVSSSNRNFEGRQ--GPGGRTHLASPALVAAAAIAG 459
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
45-775 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1230.51  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    45 YDLLEKNINIVRKRLN-RPLTLSEKIVYGHLDDPAN----QEIE--RGKTYLRLRPDRVAMRDATAQMAMLQFISSGLPK 117
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   118 VAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPN 197
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   198 GGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISC 277
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   278 TGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDH---LVPDSGCHYDQLIEINLSELKPHINGPFT 354
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTGQYSffkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   355 PDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   435 ILRDVGGIVLANACGPCIGQWDRKD-IKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDF 513
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   514 LTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDS-SGQQVDVSPTSQRLQLLEPFDKWDGRDLEDLQILIKVKGKC 592
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSPnPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   593 TTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNaVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSRE 672
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYD-LDGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   673 HAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAP---GKPLTCIIKHPNGTQ 749
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 27806769   750 ETILLNHTFNETQIEWFRAGSALNRM 775
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
61-780 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 894.12  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   61 RPLTLSEKIVYGHLDDPanqEIERGKTyLRLRPDRVAMRDATAQMAMLQFISSGLPKVAVPSTI-HCDHlieaqlggekD 139
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  140 LRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAG 219
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  220 IPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  300 NHRMKKYLSKTGRADIAnladefkDHLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGsvaekegwPLDIRV 379
Cdd:PRK07229 227 DERTREFLKAQGREDDW-------VELLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVDQ 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  380 GLIGSCTNSSYEDMGRSAAVAKqalAHGLQCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwdrkD 459
Cdd:PRK07229 292 VLIGSCTNSSYEDLMRAASILK---GKKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM----G 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  460 IKKGEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKfNPETdfLTGKDGKKFKLEAPDadelpraEFDP 539
Cdd:PRK07229 365 QAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRT--LALENGEYPKLEEPE-------GFAV 433
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  540 GQDTYQHPPKDSSGQQVDVSPTSQRLQLLEPFDkwdgrDLEDLQILIKVKGKCTTDHISAAGP-WLKFRGHLDNISNNLL 618
Cdd:PRK07229 434 DDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFVF 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  619 IGAINVENGKAnsvrnavtQEFGPvpdtaryykkhgirWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETN 698
Cdd:PRK07229 509 EGVDNTFPERA--------KEQGG--------------GIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKAN 566
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  699 LKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAPGKPLTCIIKHPNgtqETILLNHTFNETQIEWFRAGSALNRMKEL 778
Cdd:PRK07229 567 LINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKD---EEIEVRHTLSERQIEILLAGGALNLIKKK 643

                 ..
gi 27806769  779 QK 780
Cdd:PRK07229 644 LA 645
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
95-505 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134 [Multi-domain]  Cd Length: 412  Bit Score: 867.52  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  95 RVAMRDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIH 174
Cdd:cd01584   1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 175 QIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGI 254
Cdd:cd01584  81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 255 LTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFK-DHLVPDSGCH 333
Cdd:cd01584 161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKdDLLVADEGAE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 334 YDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQ 413
Cdd:cd01584 241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 414 FTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSP 493
Cdd:cd01584 321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                       410
                ....*....|..
gi 27806769 494 EIVTALAIAGTL 505
Cdd:cd01584 401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
30-777 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 708.33  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  30 AKVAMSHFEPNEYIRYDLLEkninIVRKRLNRPLTLSEKIVYGHLDDPAN------QEIERGK------TYLRLRPDRVA 97
Cdd:COG1048   4 KARKTLTVGGKTYYYYDLPK----LEESGKISKLPYSLKILLENLLRGEDgteehiEALARWLpsgkpeKEIAFRPARVV 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  98 MRDATAQMAmlQFISSGLPKVA-------------VPSTIHCDHLIEAQLGG-----EKDLRRAKDINQEVYNFLATA-G 158
Cdd:COG1048  80 MQDFTGVPA--VVDLAAMRDAMvelggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAaK 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 159 AKYGVGFWRPGSGIIHQIILENYA-----YPGVL----LIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKV 229
Cdd:COG1048 158 AFYNFRVVPPGTGIIHQVNLEYLAkvvwaKPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEV 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 230 IGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSK 309
Cdd:COG1048 238 VGVKLTGKLPEGVTATDLVLTVTGMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRL 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 310 TGRADIAN-LADEFKD-----HLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEK------------- 370
Cdd:COG1048 318 TGRSEEQVaLVEAYAKaqglwYDPADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKilreieikrvysl 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 371 ---EGWPLDIRVGLIGSCTNSSYEDMGRSAA-VAKQALAHGLQCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVL 444
Cdd:COG1048 398 lgkELGDGKVVIAAITSCTNTSNPDVLIAAGlLAKKAVEKGLKVKPwvKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIV 477
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 445 ANACGPCIGQWDR--KDIKKG-EKNTIVT----SYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKFNPETDFL--- 514
Cdd:COG1048 478 GYGCTTCIGNSGPlpEEIEKAiNDNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgtd 556
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 515 -TGKDGKKFKLEAPDADELPRAEFDPGQDTYQHP--------PKDSSGQQVDVSPTSQRLQLLEPFDKWDG---RDLEDL 582
Cdd:COG1048 557 nDGKPVYLKDIWPSTEEIAEAVGKAVKPEMFRKEyadvfkwnAIEVPEGPLYDWPNISTYIRLPPFFDGMGaepKPIKGA 636
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 583 QILIKVKGKCTTDHISAAG--------PWLKFRGHLDNISNNLLIGAINVENGKAN------SVRN---------AVTQE 639
Cdd:COG1048 637 RVLAKLGDSITTDHISPAGsikadspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNemvpgeggyTIHQP 716
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 640 FGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIH 719
Cdd:COG1048 717 SGEIYDAAMKYKEEGIPLVVVAGKNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLG 796
                       810       820       830       840       850       860
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27806769 720 PVDKLTIK--GLKDFAPGKPLTCIIKHPNGTQETI-LLNHTFNETQIEWFRAGSALNRMKE 777
Cdd:COG1048 797 LDGEETIDigGLENLKPGATVTVTVTRGDGPVEEFpVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
67-503 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 334011 [Multi-domain]  Cd Length: 459  Bit Score: 531.21  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    67 EKIVYGHLDDpanqEIERGKTYLrlrPDRVAMRDATAQMAMLQFISSGLPK-----------VAVPSTIHCDHLIEaqlg 135
Cdd:pfam00330   1 EKIWDAHLVE----EEGRGLLYI---PDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDHSIQ---- 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   136 gEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNggglggicigvggADAV 214
Cdd:pfam00330  70 -EKNIEDEISRNKEQYDFLKWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTThgglgalafgvggSEAE 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   215 DVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATT 294
Cdd:pfam00330 149 HVLATQPLEMKKPKVIGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGIRSLSMEGRATICNMAIEYGATA 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   295 SVFPYNHRMKKYLSKTGRADIANLADEFKD----HLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAE- 369
Cdd:pfam00330 229 GLFPPDETTLDYLKATGRPEAPKGEAYDKAvalwTLASDPDAVYDKVVEIDLSTIEPMVTGPTRPDDAVPLSELVPDPDf 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   370 ------------------KEGWPL---DIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKS--QFTITPGSEQIRAT 426
Cdd:pfam00330 309 addlkreaaeraleymglEPGTPLkdgKVDIAFIGSCTNSSIEDLRAAAGLLKKAAEKGLKVAPgvKASVVPGSEVVRAY 388
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27806769   427 IERDGYAQILRDVGGIVLANACGPCIGQWDRKDikkgEKNTIVTSYNRNFTGRNdaNPETHAFVTSPEIVTALAIAG 503
Cdd:pfam00330 389 AEAEGLDKILEEAGFEWRGPGCSMCIGNSDRLP----PGERCVSSSNRNFEGRQ--GPGGRTHLASPALVAAAAIAG 459
Aconitase cd01351
Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and ...
95-505 3.39e-169

Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Aconitase catalytic domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. Aconitase, in its active form, contains a 4Fe-4S iron-sulfur cluster; three cysteine residues have been shown to be ligands of the 4Fe-4S cluster. This is the Aconitase core domain, including structural domains 1, 2 and 3, which binds the Fe-S cluster. The aconitase family also contains the following proteins: - Iron-responsive element binding protein (IRE-BP), a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 153129 [Multi-domain]  Cd Length: 389  Bit Score: 492.78  E-value: 3.39e-169
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  95 RVAMRDATAQMAMLQFISSGLP-KVAVPSTIHCDHLIEAQLggekdlrrAKDINQEVYNFLATAGAKYGVGFWRPGSGII 173
Cdd:cd01351   1 RVMLQDATGPMAMKAFEILAALgKVADPSQIACVHDHAVQL--------EKPVNNEGHKFLSFFAALQGIAFYRPGVGII 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 174 HQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAG 253
Cdd:cd01351  73 HQIMVENLALPGDLLVGSDSHTTSYGGLGAISTGAGGGDVAFVMAGGPAWLKKPEVVGVNLTGKLSPGVTGKDVVLKLGG 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 254 ILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDSGCH 333
Cdd:cd01351 153 IVGVDGVLNRIVEFYGEGVSSLSIEDRLTICNMMAELGATTGIFPEDKTTLKWLEATGRPLLKNLWLAFPEELLADEGAE 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 334 YDQLIEINLSELKPHINGPFTPDLAHPVAEVGSvaekegwpLDIRVGLIGSCTNSSYEDMGRSAAVAKQALahgLQCKSQ 413
Cdd:cd01351 233 YDQVIEIDLSELEPDISGPNRPDDAVSVSEVEG--------TKIDQVLIGSCTNNRYSDMLAAAKLLKGAK---VAPGVR 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 414 FTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdiKKGEKNTIVTSYNRNFTGRNDANPEtHAFVTSP 493
Cdd:cd01351 302 LIVTPGSRMVYATLSREGYYEILVDSGARILPPGCGPCMGNGAR---LVADGEVGVSSGNRNFPGRLGTYER-HVYLASP 377
                       410
                ....*....|..
gi 27806769 494 EIVTALAIAGTL 505
Cdd:cd01351 378 ELAAATAIAGKI 389
acon_putative TIGR01342
aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins ...
64-777 1.17e-121

aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]


Pssm-ID: 130409 [Multi-domain]  Cd Length: 658  Bit Score: 380.10  E-value: 1.17e-121
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    64 TLSEKIVYGHLddpANQEIERGKTyLRLRPDRVAMRDATAQMAMLQFISSGLPKVAVP-STIHCDHLIEaqlggEKDLRR 142
Cdd:TIGR01342   1 TLAEKIIDDHL---VEGDLEPGEE-IAIEIDQTLSQDATGTMCWLEFEALEMDEVKTElAAQYCDHNML-----QFDFKN 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   143 AKDinqevYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPW 222
Cdd:TIGR01342  72 ADD-----HKFLMSAAGKFGAWFSKPGNGICHNVHKENFAAPGKTLLGSDSHTPTAGGLGMLAIGAGGIDIAAAMAGEAF 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   223 ELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHR 302
Cdd:TIGR01342 147 YLEMPEIVGVHLEGELPEWATAKDIILELLRRLSVKGGLGKIFEYFGEGVEELSVPERATITNMGAELGATSSIFPSDDI 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   303 MKKYLSKTGRadianlADEFKDhLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVgsvaekEGWPLDIRVglI 382
Cdd:TIGR01342 227 TEAWLAAFDR------EDDFVD-LLADADAEYADEIEIDLSDLEPLIAEPHMPDNVVPVREI------AGIEVDQVM--I 291
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   383 GSCTNSSYEDMGRSAAVAKQALAHGlqcKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwdrkDIKK 462
Cdd:TIGR01342 292 GSCTNGAFEDLLPAAKLLEGREVHK---DTEFAVAPGSKQALELIAQEGALAEFLAAGANFLEAACGACIGI----GFAP 364
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   463 GEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLkFNPETdfLTGKDGkkfKLEAPDAdELPrAEFDPGQD 542
Cdd:TIGR01342 365 ASDGVSLRSFNRNFEGRA-GIEDAKVYLASPETATAAAIAGEI-IDPRD--LADDEG---DLEAIGF-EMG-EKFPGGYD 435
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   543 ---TYQHPPKDSSGQQVDVSPTSQRLQLLEPFdkwdGRDLEDlQILIKVKGKCTTDHISAAGP-WLKFRGHLDNISNNLL 618
Cdd:TIGR01342 436 aadIDIIPKEEREDDDIIKGPNIKPLPEFDPL----GADIEG-ETALIMEDNITTDHIIPAGAdILKFRSNIEAISEFTL 510
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   619 igainvengkansvrNAVTQEFGPVPDTARYYKKHGIrwvVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETN 698
Cdd:TIGR01342 511 ---------------HRIDDEFAERAKAADEKGKAGI---IIAGENYGQGSSREHAALAPMFLGVEAVIAKSFARIHHAN 572
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   699 LKKQGLLPLTFADPADYNKIHPVDKLTIKG--LKDFAPGKPLTCIIKHpngTQETILLNHTFNETQIEWFRAGSALNRMK 776
Cdd:TIGR01342 573 LFNFGILPLEFDNEEDYAKFELGDDIEIPDdlAAALADGEDEFTINKN---DDEEALATLDASEREKEILAAGGKLNLIK 649

                  .
gi 27806769   777 E 777
Cdd:TIGR01342 650 N 650
AcnA_Mitochon_Swivel cd01578
Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and ...
587-735 1.52e-108

Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 238810 [Multi-domain]  Cd Length: 149  Bit Score: 327.50  E-value: 1.52e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 587 KVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYG 666
Cdd:cd01578   1 KAKGKCTTDHISAAGPWLKYRGHLDNISNNLLIGAINAENGKANSVKNQVTGEYGPVPDTARDYKAHGIKWVVIGDENYG 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 27806769 667 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAPG 735
Cdd:cd01578  81 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYDKIHPDDKVDILGLTDFAPG 149
AcnA_Bact cd01585
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
94-505 6.15e-105

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Bacterial Aconitase-like catalytic domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This distinct subfamily is found only in bacteria and Archaea. Its exact characteristics are not known.


Pssm-ID: 153135 [Multi-domain]  Cd Length: 380  Bit Score: 326.71  E-value: 6.15e-105
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  94 DRVAMRDATAQMAMLQFISSGLPKVAVP-STIHCDHLIeAQLGGEkdlrrakdiNQEVYNFLATAGAKYGVGFWRPGSGI 172
Cdd:cd01585   1 DQTLTQDATGTMAYLQFEAMGVDRVRTElSVSYVDHNT-LQTDFE---------NADDHRFLQTVAARYGIYFSRPGNGI 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 173 IHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVA 252
Cdd:cd01585  71 CHQVHLERFAVPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYYIPMPKVVGVRLTGELPPWVTAKDVILELL 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 253 GILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRadianlADEFKDhLVPDSGC 332
Cdd:cd01585 151 RRLTVKGGVGKIFEYTGPGVATLSVPERATITNMGAELGATTSIFPSDERTREFLAAQGR------EDDWVE-LAADADA 223
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 333 HYDQLIEINLSELKPHINGPFTPDLAHPVAEVGsvaekegwPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGlqcKS 412
Cdd:cd01585 224 EYDEEIEIDLSELEPLIARPHSPDNVVPVREVA--------GIKVDQVAIGSCTNSSYEDLMTVAAILKGRRVHP---HV 292
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 413 QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDrkdiKKGEKNTIVTSYNRNFTGRNdANPETHAFVTS 492
Cdd:cd01585 293 SMVVAPGSKQVLEMLARNGALADLLAAGARILESACGPCIGMGQ----APPTGGVSVRTFNRNFEGRS-GTKDDLVYLAS 367
                       410
                ....*....|...
gi 27806769 493 PEIVTALAIAGTL 505
Cdd:cd01585 368 PEVAAAAALTGVI 380
aconitase_1 TIGR01341
aconitate hydratase 1; This model represents one form of the TCA cycle enzyme aconitate ...
68-773 2.62e-77

aconitate hydratase 1; This model represents one form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It is found in bacteria, archaea, and eukaryotic cytosol. It has been shown to act also as an iron-responsive element binding protein in animals and may have the same role in other eukaryotes. [Energy metabolism, TCA cycle]


Pssm-ID: 273562 [Multi-domain]  Cd Length: 876  Bit Score: 267.05  E-value: 2.62e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    68 KIVYGHLDDPANQEIERGK-TYLRLRPDRVAMRDATAQMAMLQFIS--------SGLPKV---AVPSTIHCDHLIEAQLG 135
Cdd:TIGR01341  40 SITEEDIENILKWKIGEVAdTEIAFKPARVVMQDFTGVPAVVDLAAmreamknlGGDPKKinpLVPVDLVIDHSVQVDYY 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   136 G-----EKDLRRAKDINQEVYNFLatagaKYGVGFWR------PGSGIIHQIILE--------------NYAYPGVLlIG 190
Cdd:TIGR01341 120 GteyalEFNMELEFERNLERYQFL-----KWAQKAFRnfrvvpPGTGIIHQVNLEylatvvfkaevdgeLTAYPDSL-VG 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   191 TDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGP 270
Cdd:TIGR01341 194 TDSHTTMINGLGVLGWGVGGIEAEAAMLGQPYYMNVPEVIGVKLTGKLQEGVTATDLVLTVTQMLRKKGVVGKFVEFFGP 273
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   271 GVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRAD--------IANLADEFKDHLVPDSgchYDQLIEINL 342
Cdd:TIGR01341 274 GLSELSLADRATIANMAPEYGATCGFFPIDDVTLQYLRLTGRDGdhvelvekYARAQGLFYDDSEEPR---YTDVVELDL 350
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   343 SELKPHINGPFTPD---------------LAHPVAEVGSVAEKEGWPL------------DIRVGLIGSCTNSS--YEDM 393
Cdd:TIGR01341 351 SDVEPSVAGPKRPQdriplrevkakfskeLEKNGGDKGFTLRKEPLKKkvngqnkqledgAVVIAAITSCTNTSnpSVML 430
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   394 GrSAAVAKQALAHGLQCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG------QWDRKDIKKGEK 465
Cdd:TIGR01341 431 G-AGLLAKKAVELGLKVPPyvKTSLAPGSKVVTDYLAESGLLPYLEELGFNLVGYGCTTCIGnsgplpKYVEEAIKKNDL 509
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   466 NTI-VTSYNRNFTGRndANPETHA-FVTSPEIVTALAIAGTLKFNPETDFL-TGKDGKK--FKLEAPDADE--------- 531
Cdd:TIGR01341 510 EVYaVLSGNRNFEGR--IHPLVKGnYLASPPLVVAYALAGNIDINLYTEPIgTDKDGKPvyLRDIWPSNKEiaayvnmav 587
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   532 ---LPRAEFD--------------PGQDTYQHPPKDSsgqQVDVSPTSQRLQL-LEPFDkwdgrDLEDLQILIKVKGKCT 593
Cdd:TIGR01341 588 kpeMFKKEYEnifegnerwnsiktPSGDTYSWDEKST---YIRLPPFFEEMKQdPEEVE-----DIKGARILLLLGDSIT 659
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   594 TDHISAAGP---------WLK----------------------FRGHLDN--ISNNLLIGainVENGKAnsvRNAVTQEF 640
Cdd:TIGR01341 660 TDHISPAGSitkdspagkYLQergvsrrdfnsygsrrgnhevmMRGTFANirIKNLMVKG---KEGGYT---VHFPDGKV 733
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   641 GPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFAD--PADYNKI 718
Cdd:TIGR01341 734 ASVYDAAMQYKKEGTPLVVIAGKEYGSGSSRDWAAKGTKLLGVKAVIAESFERIHRSNLVGMGVIPLQFPQgeDAETLGL 813
                         810       820       830       840       850
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 27806769   719 HPVDKLTIKGLKDFAPGKPLTCIIKHPNGTQETILLNHTF-NETQIEWFRAGSALN 773
Cdd:TIGR01341 814 TGDETIDIDGIKDLKPGKEVTVTFTNSKGEKITFKCVLRIdTEVELDYYKHGGILQ 869
acnA PRK12881
aconitate hydratase; Provisional
94-775 5.37e-75

aconitate hydratase; Provisional


Pssm-ID: 237246 [Multi-domain]  Cd Length: 889  Bit Score: 261.02  E-value: 5.37e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   94 DRVAMRDATAQMAmlqfissGLPKV---AVPSTIHCDHLIEAQLGGEKD-LRRAKDI----NQEVYNFLA-TAGAKYGVG 164
Cdd:PRK12881  99 DLAAMRDAAAEAG-------GDPAKinpLVPVDLVVDHSVAVDYFGQKDaLDLNMKIefqrNAERYQFLKwGMQAFDNFR 171
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  165 FWRPGSGIIHQIILE--------------NYAYPGVLlIGTDSHTPnggglggicigvgGADAVDVTA------------ 218
Cdd:PRK12881 172 VVPPGTGIMHQVNLEylarvvhtkeddgdTVAYPDTL-VGTDSHTT-------------MINGIGVLGwgvggieaeavm 237
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  219 -GIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVF 297
Cdd:PRK12881 238 lGQPVYMLIPDVVGVELTGKLREGVTATDLVLTVTEMLRKEGVVGKFVEFFGEGVASLTLGDRATIANMAPEYGATMGFF 317
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  298 PYNHRMKKYLSKTGRAD--IANLADEFKDH---LVPDSGCHYDQLIEINLSELKPHINGP---------------FTPDL 357
Cdd:PRK12881 318 PVDEQTLDYLRLTGRTEaqIALVEAYAKAQglwGDPKAEPRYTRTLELDLSTVAPSLAGPkrpqdrialgnvksaFSDLF 397
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  358 AHPVAEVG-SVAEKEGWPLDIRVG-----LIGSCTNSSYEDMGRSAA-VAKQALAHGLQCKS--QFTITPGSEQIRATIE 428
Cdd:PRK12881 398 SKPVAENGfAKKAQTSNGVDLPDGavaiaAITSCTNTSNPSVLIAAGlLAKKAVERGLTVKPwvKTSLAPGSKVVTEYLE 477
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  429 RDGYAQILRDVG-GIVlANACGPCIGQWD------RKDIKKGE-KNTIVTSYNRNFTGRNDANPEThAFVTSPEIVTALA 500
Cdd:PRK12881 478 RAGLLPYLEKLGfGIV-GYGCTTCIGNSGpltpeiEQAITKNDlVAAAVLSGNRNFEGRIHPNIKA-NFLASPPLVVAYA 555
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  501 IAGTLKFNPETDFL-TGKDGKKFKLE-----APDADELPRAEFDPgqDTYQH-----PPKDSSGQQVDVsPTSQRLQ--- 566
Cdd:PRK12881 556 LAGTVRRDLMTEPLgKGKDGRPVYLKdiwpsSAEIDALVAFAVDP--EDFRKnyaevFKGSELWAAIEA-PDGPLYDwdp 632
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  567 ----LLEP--FDKWDG-----RDLEDLQILIKVKGKCTTDHIS---------AAGPWLKFRGHLDNISN----------- 615
Cdd:PRK12881 633 kstyIRRPpfFDFSMGpaasiATVKGARPLAVLGDSITTDHISpagaikadsPAGKYLKENGVPKADFNsygsrrgnhev 712
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  616 ------------NLLIGAINVENGkansvRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGG 683
Cdd:PRK12881 713 mmrgtfanvrikNLMIPGKEGGLT-----LHQPSGEVLSIYDAAMRYQAAGTPLVVIAGEEYGTGSSRDWAAKGTRLLGV 787
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  684 RAIITKSFARIHETNLKKQGLLPLTF--ADPADYNKIHPVDKLTIKGL-KDFAPGKPLTCIIKHPNGTQETILLNHTFnE 760
Cdd:PRK12881 788 KAVIAESFERIHRSNLVGMGVLPLQFkgGDSRQSLGLTGGETFDIEGLpGEIKPRQDVTLVIHRADGSTERVPVLCRI-D 866
                        810
                 ....*....|....*..
gi 27806769  761 TQIE--WFRAGSALNRM 775
Cdd:PRK12881 867 TPIEvdYYKAGGILPYV 883
PRK09277 PRK09277
aconitate hydratase; Validated
97-774 4.24e-73

aconitate hydratase; Validated


Pssm-ID: 236445 [Multi-domain]  Cd Length: 888  Bit Score: 255.43  E-value: 4.24e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   97 AMRDATAQMamlqfissGL------PKVAVPSTIhcDHLIEAQLGGEKD-LRRAKDI----NQEVYNFLatagaKYGVGF 165
Cdd:PRK09277 103 AMRDAIADL--------GGdpakinPLVPVDLVI--DHSVQVDYFGTPDaFEKNVELeferNEERYQFL-----KWGQKA 167
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  166 WR------PGSGIIHQIILE-------------NYAYPGVLlIGTDSHTPnggglggicigvgGADAVDVTA----GI-- 220
Cdd:PRK09277 168 FDnfrvvpPGTGICHQVNLEylapvvwtredgeLVAYPDTL-VGTDSHTT-------------MINGLGVLGwgvgGIea 233
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  221 -------PWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGAT 293
Cdd:PRK09277 234 eaamlgqPSSMLIPEVVGVKLTGKLPEGVTATDLVLTVTEMLRKKGVVGKFVEFFGEGLASLSLADRATIANMAPEYGAT 313
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  294 TSVFPYNHRMKKYLSKTGRAD--IAnladefkdhLV------------PDSGCHYDQLIEINLSELKPHINGP------- 352
Cdd:PRK09277 314 CGFFPIDEETLDYLRLTGRDEeqVA---------LVeayakaqglwrdPLEEPVYTDVLELDLSTVEPSLAGPkrpqdri 384
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  353 FTPDLAHPVAEV--------GSVAEKEGWPLDIRVG-----LIGSCTNSS--YEDMGrsAA-VAKQALAHGLQCKS--QF 414
Cdd:PRK09277 385 PLSDVKEAFAKSaelgvqgfGLDEAEEGEDYELPDGavviaAITSCTNTSnpSVMIA--AGlLAKKAVEKGLKVKPwvKT 462
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  415 TITPGSEQIRATIERDGYAQILRDVG-GIVlANACGPCIG---------QwdrKDIKkgEKNTIVT---SYNRNFTGRnd 481
Cdd:PRK09277 463 SLAPGSKVVTDYLEKAGLLPYLEALGfNLV-GYGCTTCIGnsgplppeiE---KAIN--DNDLVVTavlSGNRNFEGR-- 534
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  482 ANPETHA-FVTSPEIVTALAIAGTLKFNPETDFL-TGKDGKKFKLEA--PDADE------------LPRAEFDP---GQD 542
Cdd:PRK09277 535 IHPLVKAnYLASPPLVVAYALAGTVDIDLEKDPLgTDKDGNPVYLKDiwPSDEEidavvakavkpeMFRKEYADvfeGDE 614
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  543 TYQHPPKdSSGQQVDVSPTSQRLQlLEPFdkWDG--------RDLEDLQILIKVKGKCTTDHIS---------AAGPWLK 605
Cdd:PRK09277 615 RWNAIEV-PEGPLYDWDPDSTYIR-NPPY--FEGmlaepgpvRDIKGARVLALLGDSITTDHISpagaikadsPAGKYLL 690
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  606 --------F--------------RGHLDNIS--NNLLIGainVENGKAnsvRNAVTQEFGPVPDTARYYKKHGIRWVVIG 661
Cdd:PRK09277 691 ehgvepkdFnsygsrrgnhevmmRGTFANIRirNEMVPG---VEGGYT---RHFPEGEVMSIYDAAMKYKEEGTPLVVIA 764
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  662 DENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYN--KIHPVDKLTIKGLKDFAPGKPLT 739
Cdd:PRK09277 765 GKEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKPGESRKtlGLDGTETFDIEGLEDLKPGATVT 844
                        810       820       830
                 ....*....|....*....|....*....|....*.
gi 27806769  740 CIIKHPNGTQETI-LLNHTFNETQIEWFRAGSALNR 774
Cdd:PRK09277 845 VVITRADGEVVEFpVLCRIDTAVEVDYYRNGGILQY 880
PRK00402 PRK00402
3-isopropylmalate dehydratase large subunit; Reviewed
62-503 1.29e-67

3-isopropylmalate dehydratase large subunit; Reviewed


Pssm-ID: 234748 [Multi-domain]  Cd Length: 418  Bit Score: 229.29  E-value: 1.29e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   62 PLTLSEKIVYGHlddpANQEIERGKtYLRLRPDRVAMRDATAQMAMLQFISSGLPKVAVPSTIH--CDHLIEAqlggeKD 139
Cdd:PRK00402   2 GMTLAEKILARH----SGRDVSPGD-IVEAKVDLVMAHDITGPLAIKEFEKIGGDKVFDPSKIVivFDHFVPA-----KD 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  140 LRRAKdINQEVYNFLATAGAKYgvgFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNggglggicigvggADAV---- 214
Cdd:PRK00402  72 IKSAE-QQKILREFAKEQGIPN---FFDVGEGICHQVLPEKgLVRPGDVVVGADSHTCT-------------YGALgafa 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  215 ------DVTAGIP----WeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATIC 284
Cdd:PRK00402 135 tgmgstDMAAAMAtgktW-FKVPETIKVVLEGKLPPGVTAKDVILHIIGDIGVDGATYKALEFTGETIEALSMDERMTLA 213
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  285 NMGAEIGATTSVFPYNHRMKKYLSKTGRADIanladefkDHLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEV 364
Cdd:PRK00402 214 NMAIEAGAKAGIFAPDEKTLEYLKERAGRDY--------KPWKSDEDAEYEEVYEIDLSKLEPQVAAPHLPDNVKPVSEV 285
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  365 gsvaekEGWPLDIRVglIGSCTNSSYEDMGRSAAVAK-QALAHGLQCKsqftITPGSEQIRATIERDGYAQILRDVGGIV 443
Cdd:PRK00402 286 ------EGTKVDQVF--IGSCTNGRLEDLRIAAEILKgRKVAPGVRLI----VIPASQKIYLQALKEGLIEIFVDAGAVV 353
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  444 LANACGPCIGqwdrkdIKKGEknTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAG 503
Cdd:PRK00402 354 STPTCGPCLGghm-gvLAPGE--VCLSTTNRNFKGRM-GSPESEVYLASPAVAAASAVTG 409
IPMI cd01583
3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and ...
95-503 5.86e-64

3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Aconatase-like catalytic domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes.


Pssm-ID: 153133 [Multi-domain]  Cd Length: 382  Bit Score: 218.21  E-value: 5.86e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  95 RVAMRDATAQMAMLQFISSGLPKVAVPSTIHC--DHLIEAqlggekDLRRAKDINQEVYNFLATAGAK-YGVGfwrpGSG 171
Cdd:cd01583   1 LHLVHDVTSPQAFEGLREAGREKVWDPEKIVAvfDHNVPT------PDIKAAEQVKTLRKFAKEFGINfFDVG----RQG 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 172 IIHQIILENY-AYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVIL 249
Cdd:cd01583  71 ICHVILPEKGlTLPGMTIVGGDSHTCTHGAFGAFATGIGTTDVAHVLAtGKLW-FRVPETMRVNVEGKLPPGVTAKDVIL 149
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 250 KVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRAdianladEFKdHLVPD 329
Cdd:cd01583 150 YIIGKIGVDGATYKAMEFAGEAIESLSMEERMTLCNMAIEAGAKAGIVAPDETTFEYLKGRGKA-------YWK-ELKSD 221
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 330 SGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVgsvaekEGWPLDIRVglIGSCTNSSYEDMGRSAAVAKqalAHGLQ 409
Cdd:cd01583 222 EDAEYDKVVEIDASELEPQVAWPHSPDNVVPVSEV------EGIKIDQVF--IGSCTNGRLEDLRAAAEILK---GRKVA 290
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 410 CKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG-QWDRkdIKKGEknTIVTSYNRNFTGR-NDANPETH 487
Cdd:cd01583 291 DGVRLIVVPASQRVYKQAEKEGLIEIFIEAGAEVRPPGCGACLGgHMGV--LAPGE--RCVSTSNRNFKGRmGSPGARIY 366
                       410
                ....*....|....*.
gi 27806769 488 afVTSPEIVTALAIAG 503
Cdd:cd01583 367 --LASPATAAASAITG 380
PTZ00092 PTZ00092
aconitate hydratase-like protein; Provisional
94-773 2.64e-61

aconitate hydratase-like protein; Provisional


Pssm-ID: 240263 [Multi-domain]  Cd Length: 898  Bit Score: 222.19  E-value: 2.64e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   94 DRVAMRDAtaqMAML----QFISsglPKVAVPSTIhcDHLIEAQLGGEKD-LRRAKDI----NQEVYNFLatagaKYGVG 164
Cdd:PTZ00092 106 DLAAMRDA---MKRLggdpAKIN---PLVPVDLVI--DHSVQVDFSRSPDaLELNQEIeferNLERFEFL-----KWGSK 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  165 FWR------PGSGIIHQIILE----------NYAYPGVLlIGTDSHTP--NGGGLGGICIGVGGADAVdvTAGIPWELKC 226
Cdd:PTZ00092 173 AFKnllivpPGSGIVHQVNLEylarvvfnkdGLLYPDSV-VGTDSHTTmiNGLGVLGWGVGGIEAEAV--MLGQPISMVL 249
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  227 PKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY 306
Cdd:PTZ00092 250 PEVVGFKLTGKLSEHVTATDLVLTVTSMLRKRGVVGKFVEFYGPGVKTLSLADRATIANMAPEYGATMGFFPIDEKTLDY 329
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  307 LSKTGRAD-----IANLADEFKDHLVPDSGCHYDQLIEINLSELKPHINGP---------------FTPDLAHPVAEVG- 365
Cdd:PTZ00092 330 LKQTGRSEekvelIEKYLKANGLFRTYAEQIEYSDVLELDLSTVVPSVAGPkrphdrvplsdlkkdFTACLSAPVGFKGf 409
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  366 SVAEKE----------GWPLDIRVG-----LIGSCTNSSYED-MGRSAAVAKQALAHGLQCKS--QFTITPGSEQIRATI 427
Cdd:PTZ00092 410 GIPEEKhekkvkftykGKEYTLTHGsvviaAITSCTNTSNPSvMLAAGLLAKKAVEKGLKVPPyiKTSLSPGSKVVTKYL 489
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  428 ERDGYAQILRDVGGIVLANACGPCIGqwDRKDIKKGEKNTI---------VTSYNRNFTGRndANPETHA-FVTSPEIVT 497
Cdd:PTZ00092 490 EASGLLKYLEKLGFYTAGYGCMTCIG--NSGDLDPEVSEAItnndlvaaaVLSGNRNFEGR--VHPLTRAnYLASPPLVV 565
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  498 ALAIAGTLKFNPETDFL-TGKDGKKFKLEA--PDADEL--------------------------------PRAEF---DP 539
Cdd:PTZ00092 566 AYALAGRVNIDFETEPLgSDKTGKPVFLRDiwPSREEIqaleakyvkpemfkevysnitqgnkqwnelqvPKGKLyewDE 645
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  540 gQDTYQHPPKDSSGQQVDVSPTsqrlqllepfdkwdgRDLEDLQILIKVKGKCTTDHISAAG------PWLKF------- 606
Cdd:PTZ00092 646 -KSTYIHNPPFFQTMELEPPPI---------------KSIENAYCLLNLGDSITTDHISPAGniaknsPAAKYlmergve 709
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  607 ------------------RGHLDNIS-NNLLIGA-----INVENGKANSVRNAvtqefgpvpdtARYYKKHGIRWVVIGD 662
Cdd:PTZ00092 710 rkdfntygarrgndevmvRGTFANIRlINKLCGKvgpntVHVPTGEKMSIYDA-----------AEKYKQEGVPLIVLAG 778
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  663 ENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFAD--PADYNKIHPVDKLTIKGLK-DFAPGKPLT 739
Cdd:PTZ00092 779 KEYGSGSSRDWAAKGPYLQGVKAVIAESFERIHRSNLVGMGILPLQFLNgeNADSLGLTGKEQFSIDLNSgELKPGQDVT 858
                        810       820       830
                 ....*....|....*....|....*....|....*
gi 27806769  740 ciIKHPNG-TQETILLNHTfnETQIEWFRAGSALN 773
Cdd:PTZ00092 859 --VKTDTGkTFDTILRIDT--EVEVEYFKHGGILQ 889
LeuC COG0065
Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] ...
61-505 6.10e-61

Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism];


Pssm-ID: 223143 [Multi-domain]  Cd Length: 423  Bit Score: 211.29  E-value: 6.10e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  61 RPLTLSEKIVYGHLDDPanqEIERGKTYLrLRPDRVAMRDATAQMAMLQFISSGLpKVAVPSTIHC--DHLIEAqlggeK 138
Cdd:COG0065   1 SAKTLYEKILDAHVGKE---EVGAGETVL-LYIDLHLVHDVTSPQAFEGLREAGR-KVRDPEKTVAtfDHNVPT-----P 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 139 DLRRAKDInQEVYNFLATAGAK--YGVGfwrpGSGIIHQIILEN-YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVD 215
Cdd:COG0065  71 DIKAAEQQ-KELRENAKEFGIVnfYDVG----DQGIVHQVGPEQgLTLPGMTIVGGDSHTCTHGAFGAFAFGIGTTDVAH 145
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 216 VTA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATT 294
Cdd:COG0065 146 VLAtGKLW-FRVPKTMKVEVEGKLPPGVTAKDIILALIGKIGVDGGTGYAIEFAGEAIRSLSMEGRMTLCNMAIEAGAKA 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 295 SVFPYNHRMKKYLSKTGRADianlaDEFKDhLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVgsvaekEGWP 374
Cdd:COG0065 225 GIIAPDETTFEYLKEWDGAV-----AYWKT-LKSDEDAVYDKVVELDASDLEPQVAWPTNPDNVVPVSEV------EPDP 292
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 375 LDIRVGLIGSCTNSSYEDMGRSAAVAK-QALAHGLQCksqfTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG 453
Cdd:COG0065 293 IKIDQVFIGSCTNGRIEDLRAAAEILKgRKVAPGVRA----IVVPGSRRVKEQAEKEGLDKIFIEAGFEWREPGCGPCLG 368
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|...
gi 27806769 454 qwdRKDIKKGEKNTIVTSYNRNFTGR-NDANPETHafVTSPEIVTALAIAGTL 505
Cdd:COG0065 369 ---MHPGVLGPGERCASTSNRNFEGRqGSPGARTY--LASPAMAAAAAVEGEI 416
Aconitase_C pfam00694
Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This ...
582-712 7.75e-61

Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This domain undergoes conformational change in the enzyme mechanism.


Pssm-ID: 307028 [Multi-domain]  Cd Length: 131  Bit Score: 201.05  E-value: 7.75e-61
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   582 LQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIG 661
Cdd:pfam00694   1 MAKFLTLRGLTTPDFNSNVDTDGIIPKQFLGTIANIGIGNINFEGWRAGKTTHLPDGEKPDVYDAAERYKQHGAPIVVIA 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 27806769   662 DENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADP 712
Cdd:pfam00694  81 GKNYGSGSSREHAAWAPRDLGIKAVIAESFARIHRNNLIKNGLLPLEFPAE 131
2met_isocit_dHY TIGR02333
2-methylisocitrate dehydratase, Fe/S-dependent; Members of this family appear in an operon for ...
94-777 2.70e-59

2-methylisocitrate dehydratase, Fe/S-dependent; Members of this family appear in an operon for the degradation of propionyl-CoA via 2-methylcitrate. This family is homologous to aconitases A and B and appears to act the part as 2-methylisocitrate dehydratase, the enzyme after PrpD and before PrpB. In Escherichia coli, which lacks a member of this family, 2-methylisocitrate dehydratase activity was traced to aconitase B (TIGR00117) ().


Pssm-ID: 131386 [Multi-domain]  Cd Length: 858  Bit Score: 216.00  E-value: 2.70e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    94 DRVAMRDATAQmamlqfiSSGLP-KV--AVPSTIHCDHLIEAQLGG-EKD-LRRAKDI----NQEVYNFLA-TAGAKYGV 163
Cdd:TIGR02333  89 DLAGLRDAIAE-------KGGDPaQVnpVVPTQLIVDHSLAVEYGGfDPDaFEKNRAIedrrNEDRFHFINwTKTAFKNV 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   164 GFWRPGSGIIHQIILENY----------AYPGVLlIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVK 233
Cdd:TIGR02333 162 DVIPAGNGIMHQINLEKMspviqvkngvAFPDTC-VGTDSHTPHVDALGVIAIGVGGLEAETVMLGRASMMRLPDIVGVE 240
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   234 LTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRA 313
Cdd:TIGR02333 241 LTGKRQPGITATDIVLALTEFLRKERVVSAYLEFFGEGARALTIGDRATISNMTPEYGATAAMFYIDEQTIDYLKLTGRE 320
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   314 D--------IANLADEFKDHLvpdSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEV------GSVAEK-EGWPLD-- 376
Cdd:TIGR02333 321 PeqvklvetYAKAAGLWADSL---KHAVYERVLEFDLSSVVRNMAGPSNPHARVPTSDLaargiaGPAEEQpEGLMPDga 397
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   377 IRVGLIGSCTNSSY-EDMGRSAAVAKQALAHGLQCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG 453
Cdd:TIGR02333 398 VIIAAITSCTNTSNpRNVVAAGLLARNANQLGLKRKPwvKTSFAPGSKVAQLYLEEAGLLPELEQLGFGIVAFACTTCNG 477
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   454 QWDRKD-------IKKGEKNTIVTSYNRNFTGRndANP-ETHAFVTSPEIVTALAIAGTLKFNPETDFL-TGKDGKKFKL 524
Cdd:TIGR02333 478 MSGALDpviqqeiIDRDLYATAVLSGNRNFDGR--IHPyAKQAFLASPPLVVAYAIAGTIRFDIEKDVLgVDADGKPIRL 555
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   525 EA-----PDADELPRAEFDPGQ--DTYQhPPKDSSGQQVDVSP----TSQRLQLLEPfDKWDG-----RDLEDLQILIKV 588
Cdd:TIGR02333 556 KDiwpsdEEIDAVVAAAVKPEQfrKVYI-PMFDLDDTQSAVSPlydwRPMSTYIRRP-PYWEGalageRTLKGMRPLAIL 633
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   589 KGKCTTDHI---------SAAGPWLKFRG---------------HLD----NISNNLLIGAINVENGkanSVRNAVTQEF 640
Cdd:TIGR02333 634 GDNITTDHLspsnailadSAAGEYLAKMGlpeedfnsyathrgdHLTaqraTFANPKLFNEMVKNDG---SVKQGSLARI 710
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   641 GPVPDTARY------YKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPAD 714
Cdd:TIGR02333 711 EPEGKVTRMweaietYMNRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKPGTN 790
                         730       740       750       760       770       780
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 27806769   715 YNKIHPVDKLTIKGLKDFAPGKPLTCIIKHPNGTQETILLN---HTFNETQIewFRAGSALNRMKE 777
Cdd:TIGR02333 791 RHTLGLDGTETFDVVGEITPRADLTLVVTRKNGEKLEVPVTcrlDTAEEVSV--YEAGGVLQRFAQ 854
PLN00070 PLN00070
aconitate hydratase
94-743 1.12e-58

aconitate hydratase


Pssm-ID: 215047 [Multi-domain]  Cd Length: 936  Bit Score: 215.05  E-value: 1.12e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   94 DRVAMRDATAQMAMlqfiSSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAK-----DINQEVYNFLatagaKYGVGFWR- 167
Cdd:PLN00070 138 DLACMRDAMNNLGG----DPNKINPLVPVDLVIDHSVQVDVARSENAVQANmelefQRNKERFAFL-----KWGSTAFQn 208
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  168 -----PGSGIIHQIILENYA----------YPGVLlIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGV 232
Cdd:PLN00070 209 mlvvpPGSGIVHQVNLEYLGrvvfntdgilYPDSV-VGTDSHTTMIDGLGVAGWGVGGIEAEAAMLGQPMSMVLPGVVGF 287
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  233 KLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGR 312
Cdd:PLN00070 288 KLSGKLRDGVTATDLVLTVTQMLRKHGVVGKFVEFYGEGMSELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGR 367
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  313 AD----------IANlaDEFKDHLVPDSGCHYDQLIEINLSELKPHINGPFTPD---------------LAHPVAEVGSV 367
Cdd:PLN00070 368 SDetvamieaylRAN--KMFVDYNEPQQERVYSSYLELDLEDVEPCISGPKRPHdrvplkemkadwhscLDNKVGFKGFA 445
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  368 AEKE-----------GWPLDIRVG-----LIGSCTNSSYED-MGRSAAVAKQALAHGLQCKS--QFTITPGSEQIRATIE 428
Cdd:PLN00070 446 VPKEaqskvakfsfhGQPAELRHGsvviaAITSCTNTSNPSvMLGAGLVAKKACELGLEVKPwiKTSLAPGSGVVTKYLL 525
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  429 RDGYAQILRDVGGIVLANACGPCIGqwDRKDIKKGEKNTI---------VTSYNRNFTGRndANPETHA-FVTSPEIVTA 498
Cdd:PLN00070 526 KSGLQKYLNQQGFHIVGYGCTTCIG--NSGELDESVASAItendivaaaVLSGNRNFEGR--VHPLTRAnYLASPPLVVA 601
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  499 LAIAGTLKFNPETDFL-TGKDGKK--FKLEAPDADELPRAEF-----DPGQDTYQHPPKDS---------SGQQVDVSPT 561
Cdd:PLN00070 602 YALAGTVDIDFEKEPIgTGKDGKDvfFRDIWPSNEEVAEVVQssvlpDMFKSTYEAITKGNpmwnqlsvpSGTLYSWDPK 681
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  562 SQRLQllEP-------FDKWDGRDLEDLQILIKVKGKCTTDHISAAG------PWLKF---------------------- 606
Cdd:PLN00070 682 STYIH--EPpyfknmtMSPPGPHGVKDAYCLLNFGDSITTDHISPAGsihkdsPAAKYlmergvdrkdfnsygsrrgnde 759
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  607 ---RGHLDNIS--NNLLIGAINvengkANSVrNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHL 681
Cdd:PLN00070 760 imaRGTFANIRivNKLLKGEVG-----PKTV-HIPTGEKLSVFDAAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLL 833
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  682 GGRAIITKSFARIHETNLKKQGLLPLTF-----AD--------------PADYNKIHPVDKLTIKGLKdfapGKPLTCII 742
Cdd:PLN00070 834 GVKAVIAKSFERIHRSNLVGMGIIPLCFksgedADtlgltgherytidlPSNISEIKPGQDVTVTTDN----GKSFTCTL 909

                 .
gi 27806769  743 K 743
Cdd:PLN00070 910 R 910
IPMI_arch TIGR02086
3-isopropylmalate dehydratase, large subunit; This subfamily is a subset of the larger HacA ...
64-510 2.69e-58

3-isopropylmalate dehydratase, large subunit; This subfamily is a subset of the larger HacA family (Homoaconitate hydratase family, TIGR01343) and is most closely related to the 3-isopropylmalate dehydratase, large subunits which form TIGR00170. This subfamily includes the members of TIGR01343 which are gene clustered with other genes of leucine biosynthesis. The rest of the subfamily includes mainly archaeal species which exhibit two hits to this model. In these cases it is possible that one or the other of the hits does not have a 3-isopropylmalate dehydratase activity but rather one of the other related aconitase-like activities.


Pssm-ID: 273960 [Multi-domain]  Cd Length: 413  Bit Score: 203.84  E-value: 2.69e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    64 TLSEKIvyghLDDPANQEIERGKTYLRlRPDRVAMRDATAQMAMLQFISSGLPKVAVPSTIHC--DHLIEAqlggeKDLR 141
Cdd:TIGR02086   2 TLAEKI----LSEKVGRPVCAGEIVEV-EVDLAMTHDGTGPLAIKALRELGVARVWDPEKIVIafDHNVPP-----PTVE 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   142 RAKdINQEVYNFlataGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNGGGLGGICIGVGGAD-AVDVTAG 219
Cdd:TIGR02086  72 AAE-MQKEIREF----AKRHGIKNFDVGEGICHQILAEEgYALPGMVVVGGDSHTCTSGAFGAFATGMGATDmAIALATG 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   220 IPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:TIGR02086 147 KTW-IKVPETIRVVVEGKPEEGVTAKDVALHIVGELGADGATYMAIEFFGLPIENMDMDGRLTLCNMAVEMGAKAGIIEP 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   300 NHRMKKYLSKTGRadianlaDEFKDhLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVgsvaekEGwpLDIRV 379
Cdd:TIGR02086 226 DEETYEYLKKRRG-------LEFRI-LVPDPGANYYKEIEIDLSDLEPQVAVPHSVDNVKPVSDV------EG--TEIDQ 289
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   380 GLIGSCTNSSYEDMGRSAAVAKQalaHGLQCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGqwdRKD 459
Cdd:TIGR02086 290 VFIGSCTNGRLEDLRIAAEILKG---RRVHPDVRLIVIPASRKVYLRALEEGIILTLVRAGAMICPPGCGPCLG---AHM 363
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|.
gi 27806769   460 IKKGEKNTIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLKfNPE 510
Cdd:TIGR02086 364 GVLGDGEVCLSTTNRNFKGRM-GSPNAEIYLASPATAAASAVEGYIT-DPE 412
hacA_fam TIGR01343
homoaconitate hydratase family protein; This model represents a subfamily of proteins ...
94-503 5.52e-56

homoaconitate hydratase family protein; This model represents a subfamily of proteins consisting of aconitase, homoaconitase, 3-isopropylmalate dehydratase, and uncharacterized proteins. The majority of the members of this family have been designated as 3-isopropylmalate dehydratase large subunit (LeuC) in microbial genome annotation, but the only characterized member is Thermus thermophilus homoaconitase, an enzyme of a non-aspartate pathway of Lys biosynthesis.


Pssm-ID: 273563 [Multi-domain]  Cd Length: 412  Bit Score: 197.67  E-value: 5.52e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    94 DRVAMRDATAQMAMLQFISSGLPKVAVPSTIHC--DHLIEAqlggekDLRRAKDINQEVYNFLATAGAKYgvgFWRPGSG 171
Cdd:TIGR01343  26 DLAMVHDITAPLAIKTLEEYGIDKVWNPEKIVIvfDHQVPA------DTIKAAEMQKLAREFVKKQGIKY---FYDVGEG 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   172 IIHQIILEN-YAYPGVLLIGTDSHTPNGGGLGGICIGVGGAD-AVDVTAGIPWeLKCPKVIGVKLTGSLSGWTSPKDVIL 249
Cdd:TIGR01343  97 ICHQVLPEKgLVKPGDLVVGADSHTCTYGAFGAFATGMGSTDmAYAIATGKTW-FKVPETIRVNITGKLNPGVTAKDVIL 175
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   250 KVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADianlADEFKDhlvpD 329
Cdd:TIGR01343 176 EVIGEIGVDGATYMAMEFGGETVKNMDMEGRLTLANMAIEAGGKTGIIEPDEKTIQYLKERRKEP----FRVYKS----D 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   330 SGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVgsvaekEGWPLDiRVgLIGSCTNSSYEDMGRSAAVAKqalAHGLQ 409
Cdd:TIGR01343 248 EDAEYAKEIEIDASQIEPVVACPHNVDNVKPVSEV------EGTEID-QV-FIGSCTNGRLEDLRVAAKILK---GRKVA 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   410 CKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGqwdRKDIKKGEKNTIVTSYNRNFTGRNdANPETHAF 489
Cdd:TIGR01343 317 PDVRLIVIPASRAVYLQALKEGLIEIFVKAGAVVSTPGCGPCLG---SHQGVLAPGEVCISTSNRNFKGRM-GHPNAEIY 392
                         410
                  ....*....|....
gi 27806769   490 VTSPEIVTALAIAG 503
Cdd:TIGR01343 393 LASPATAAASAVKG 406
LEU2 TIGR02083
3-isopropylmalate dehydratase, large subunit; Homoaconitase, aconitase, and 3-isopropylmalate ...
63-505 3.88e-49

3-isopropylmalate dehydratase, large subunit; Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. These homologs are described by a separate model of subfamily (rather than equivalog) homology type (TIGR01343). This model along with TIGR00170 describe clades which consist only of LeuC sequences. Here, the genes from Pyrococcus furiosus, Clostridium acetobutylicum, Thermotoga maritima and others are gene clustered with related genes from the leucine biosynthesis pathway. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 131138 [Multi-domain]  Cd Length: 419  Bit Score: 178.86  E-value: 3.88e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    63 LTLSEKIvyghLDDPANQEIERGKTYLRLRPDRVAMRDATAQMAMLQFISSGLPKVAVPSTIHcdhLIEAQLGGEKDLRR 142
Cdd:TIGR02083   1 MTMAEKI----LAQHAGLESVEPGELILAKLDIVLGNDITTPLAIKAFKEYGGKKVFDPDRVA---LVPDHFTPNKDIKS 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   143 AKDINQeVYNFLATAGAKYgvgFWRPGS-GIIHQIILE-NYAYPGVLLIGTDSHTPNGGGLGGICIGVGGAD-AVDVTAG 219
Cdd:TIGR02083  74 AEQCKM-MREFAREQGIEK---FFEIGNmGIEHALLPEeGIVKPGDLIIGADSHTCTYGALGAFATGVGSTDmAVGMATG 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   220 IPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:TIGR02083 150 KAW-FRVPEAIKFVLKGKLKPWVTGKDLILHIIGIIGVDGALYKSMEFSGEGLKELSMDDRFTIANMAIEAGAKTGIFPV 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   300 NHRMKKYLSktGRADianlaDEFKDHlVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKegwpldIRV 379
Cdd:TIGR02083 229 DEITIEYEK--GRGK-----REEKIY-KADEDAKYVRVIEIDLSELEPQVAFPHLPENTKDISEAGKEEIK------IDQ 294
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   380 GLIGSCTNSSYEDMGRSAAVAK-QALAHGLQCksqfTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQwDRK 458
Cdd:TIGR02083 295 VVIGSCTNGRLEDLRLAAEILKgKTVAPDVRC----IIIPGSQNVYLEAMKEGLLEIFIEAGAVVSTPTCGPCLGG-HMG 369
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*..
gi 27806769   459 DIKKGEKntIVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTL 505
Cdd:TIGR02083 370 ILAEGER--AISTTNRNFVGRM-GHPKSEVYLASPAVAAASAIKGYI 413
h_aconitase TIGR00139
homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is ...
62-718 4.34e-45

homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 129245 [Multi-domain]  Cd Length: 712  Bit Score: 172.92  E-value: 4.34e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769    62 PLTLSEKIVYGH-LDDPANQEIERGKtYLRLRPDRVAMRDATAQMAmLQFISSGLPKVAVPSTI--HCDHLIEAQlgGEK 138
Cdd:TIGR00139   1 GQNLTEKIVQKYaVGLPEGKFVHSGD-YVSIKPAHCMSHDNSWPCA-LKFMGIGASKIHNPDQIvmTLDHDIQNK--SDK 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   139 DLRRAKDINqevyNFlataGAKYGVGFWRPGSGIIHQIILEN-YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVT 217
Cdd:TIGR00139  77 NLKKYKNIE----EF----AKKHGIDFYPAGRGIGHQIMIEEgFAFPGNLAVASDSHSNMYGGLGCLGTPIVRTDAAAIW 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   218 A-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPG--VDSISCTGMATICNMGAEIGATT 294
Cdd:TIGR00139 149 AtGKTW-WQIPPVAKVEFKGQLPPGVSGKDIIVALCGLFNKDDVLNHAIEFTGSEdsLNALPIDHRLTIANMTTEWGALS 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   295 SVFPYNHRMKKYLS------------------KTGRADIANLADEFKDHLVPDSGCHYDQLIEINLSELKPHINGPFTPD 356
Cdd:TIGR00139 228 GLFPIDKTLIDWLKgkatlaalgladgpfinpAAERFTHPALEEKAEIPLKADKDAHYAKELFIDLASLSHYVSGPNSVK 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   357 LAHPVAEVgsvaekEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQA----------LAHGLqcksQFTITPGSEQIRAT 426
Cdd:TIGR00139 308 VANPLKDL------EAQDIKIDKAYLVSCTNSRASDIAAAADVFCEAadknggkinkIAPGV----EFYIAAASIEEEAA 377
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   427 IERDGYAQILRDVGGIVLANACGPCIGQwDRKDIKKGEKNtiVTSYNRNFTGRNdANPETHAFVTSPEIVTALAIAGTLK 506
Cdd:TIGR00139 378 AEGNGAWEKLLEAGAIPLPAGCGPCIGL-GAGLLEPGEVG--ISASNRNFKGRM-GSKDAKAYLASPAVVAASALLGKIS 453
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   507 fnpetdfltgkdGKKFKLEAPDADELPRAEFD-----PGQDTYQHPPKDSSGQQVD-VSPTSQRLQLLEPfdKWDGRDLE 580
Cdd:TIGR00139 454 ------------GPAEVLSPEGWTEIIFGEGDgikeeDRMLTNEEALEKIIGIIDDlVADEEKNAASEAP--AQEESEQG 519
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   581 DLQILI----KVKGK---CTTDHISAAGPWLKFRGHLDNISNNLLiGAINVENGKAnsvrnavtqEFgpvpdtaRYYKKH 653
Cdd:TIGR00139 520 LTEILEgfpeEFSGElvfCDADNINTDGIYPGKYTYQDDVPKEKM-AQVCMENYDA---------EF-------RTKAHE 582
                         650       660       670       680       690       700
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 27806769   654 GIrwVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFadPADYNKI 718
Cdd:TIGR00139 583 GD--ILVSGFNFGCGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNALLGLEI--PALIKKL 643
AcnA_IRP cd01586
Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA ...
94-504 7.64e-45

Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes.


Pssm-ID: 153136 [Multi-domain]  Cd Length: 404  Bit Score: 165.94  E-value: 7.64e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  94 DRVAMRDATAQMAmlqfissGLP-KV--AVPSTIHCDHLIEAQLGG-----EKDLRRAKDINQEVYNFLATAGAKYG-VG 164
Cdd:cd01586  15 DLAAMRDAVKRLG-------GDPeKInpLIPVDLVIDHSVQVDFYGtadalAKNMKLEFERNRERYEFLKWGQKAFKnLR 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 165 FWRPGSGIIHQIILE--------------NYAYPGVLlIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVI 230
Cdd:cd01586  88 VVPPGTGIIHQVNLEylarvvftseedgdGVAYPDSV-VGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQPISMLLPEVV 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 231 GVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPynhrmkkylskt 310
Cdd:cd01586 167 GVKLTGKLRPGVTATDLVLTVTQMLRKVGVVGKFVEFFGPGVAKLSVADRATIANMAPEYGATCGFFP------------ 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 311 gradianladefkdhlvPDSgchydQLIEINLSELKPHINGPFTPDlaHPVAEVGSVAekegwpldirVGLIGSCTNSSY 390
Cdd:cd01586 235 -----------------VDT-----QVVELDLSTVEPSVSGPKRPQ--DRVPLHGSVV----------IAAITSCTNTSN 280
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 391 ED-MGRSAAVAKQALAHGLQCKS--QFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIG------QWDRKDIK 461
Cdd:cd01586 281 PSvMLAAGLLAKKAVELGLKVKPyvKTSLAPGSRVVTKYLEASGLLPYLEKLGFHVVGYGCTTCIGnsgplpEEVEEAIK 360
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*
gi 27806769 462 KGE-KNTIVTSYNRNFTGRndANPETHA-FVTSPEIVTALAIAGT 504
Cdd:cd01586 361 ENDlVVAAVLSGNRNFEGR--IHPLVRAnYLASPPLVVAYALAGT 403
Homoaconitase cd01582
Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase ...
108-505 1.04e-36

Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase catalytic domain. Homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases.


Pssm-ID: 153132 [Multi-domain]  Cd Length: 363  Bit Score: 141.60  E-value: 1.04e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 108 LQFISSGLPKVAVPSTIHC--DHliEAQLGGEKDLRRAKDINqevyNFlataGAKYGVGFWRPGSGIIHQIILEN-YAYP 184
Cdd:cd01582  13 LKFMSIGATKIHNPDQIVMtlDH--DVQNKSEKNLKKYKNIE----SF----AKKHGIDFYPAGRGIGHQIMIEEgYAFP 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 185 GVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTA-GIPWeLKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGA 263
Cdd:cd01582  83 GTLAVASDSHSNMYGGVGCLGTPIVRTDAAAIWAtGQTW-WQIPPVAKVELKGQLPKGVTGKDVIVALCGLFNKDQVLNH 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 264 IVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRmkkylsktgradianladefkdHLVpdsgchydqlieINLS 343
Cdd:cd01582 162 AIEFTGSGLNSLSVDTRLTIANMTTEWGALSGLFPTDAK----------------------HLI------------LDLS 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 344 ELKPHINGPFTPDLAHPVAEVgsvaekEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQA--------LAHGLqcksQFT 415
Cdd:cd01582 208 TLSPYVSGPNSVKVSTPLKEL------EAQNIKINKAYLVSCTNSRASDIAAAADVVKGKkekngkipVAPGV----EFY 277
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 416 ITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGqWDRKDIKKGEKNtiVTSYNRNFTGRNdANPETHAFVTSPEI 495
Cdd:cd01582 278 VAAASSEVQAAAEKNGDWQTLLEAGATPLPAGCGPCIG-LGQGLLEPGEVG--ISATNRNFKGRM-GSTEALAYLASPAV 353
                       410
                ....*....|
gi 27806769 496 VTALAIAGTL 505
Cdd:cd01582 354 VAASAISGKI 363
PRK05478 PRK05478
isopropylmalate isomerase large subunit; Validated
227-505 9.48e-31

isopropylmalate isomerase large subunit; Validated


Pssm-ID: 235490 [Multi-domain]  Cd Length: 466  Bit Score: 126.39  E-value: 9.48e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  227 PKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGA---------TTsvF 297
Cdd:PRK05478 163 PKTMKIEVDGKLPPGVTAKDIILAIIGKIGTAGGTGYVIEFAGEAIRALSMEGRMTICNMSIEAGAraglvapdeTT--F 240
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  298 PYnhrMKkylsktGR--ADIANLADEFKDH---LVPDSGCHYDQLIEINLSELKPH------------INGPF-TPDLAH 359
Cdd:PRK05478 241 EY---LK------GRpfAPKGEDWDKAVAYwktLKSDEDAVFDKVVTLDAADIEPQvtwgtnpgqvisIDGKVpDPEDFA 311
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  360 PVAEVGSVAE-------KEGWPL-DIRVG--LIGSCTNSSYEDMGRSAAVAK--------QALahglqcksqftITPGSE 421
Cdd:PRK05478 312 DPVKRASAERalaymglKPGTPItDIKIDkvFIGSCTNSRIEDLRAAAAVVKgrkvapgvRAL-----------VVPGSG 380
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  422 QIRATIERDGYAQILRDVG------GivlanaCGPCIGQWDrkDIKKGEKNTIVTSyNRNFTGRNDANPETHafVTSPEI 495
Cdd:PRK05478 381 LVKAQAEAEGLDKIFIEAGfewrepG------CSMCLAMNP--DKLPPGERCASTS-NRNFEGRQGKGGRTH--LVSPAM 449
                        330
                 ....*....|
gi 27806769  496 VTALAIAGTL 505
Cdd:PRK05478 450 AAAAAITGHF 459
Aconitase_swivel cd00404
Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible ...
587-728 1.85e-29

Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. The aconitase family contains the following proteins: - Iron-responsive element binding protein (IRE-BP). IRE-BP is a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 238236 [Multi-domain]  Cd Length: 88  Bit Score: 111.79  E-value: 1.85e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 587 KVKGKCTTDHISAAGPWlkfrghldnisnnlligainvengkansvrnavtqefgpvpdtaryykkhgirwVVIGDENYG 666
Cdd:cd00404   1 KVAGNITTDHISPAGPG------------------------------------------------------VVIGDENYG 26
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 27806769 667 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIKG 728
Cdd:cd00404  27 TGSSREHAALELRLLGGRAVIAKSFARIFFRNLVDQGLLPLEFADPEDYLKLHTGDELDIYP 88
leuC TIGR00170
3-isopropylmalate dehydratase, large subunit; Members of this family are 3-isopropylmalate ...
168-503 1.64e-28

3-isopropylmalate dehydratase, large subunit; Members of this family are 3-isopropylmalate dehydratase, large subunit, or the large subunit domain of single-chain forms. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. These homologs are now described by a separate model of subfamily (rather than equivalog) homology type, and the priors and cutoffs for this model have been changed to focus this equivalog family more narrowly. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 272940 [Multi-domain]  Cd Length: 465  Bit Score: 119.57  E-value: 1.64e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   168 PGSGIIHQIILE-NYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVTAGIPWELKCPKVIGVKLTGSLSGWTSPKD 246
Cdd:TIGR00170 103 VDQGIVHVMGPEqGLTLPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTLKQARAKTMKIEVDGKLAPGITAKD 182
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   247 VILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSktGRAdIANLADEFKDH- 325
Cdd:TIGR00170 183 IILAIIGKTGVAGGTGHVIEFCGEAIRDLSMEGRMTVCNMAIEAGARAGLIAPDETTFEYCK--GRP-HAPKGKEFDKAv 259
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   326 -----LVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEV------------GSVAEKE--------GWPL-DIRV 379
Cdd:TIGR00170 260 aywktLKTDEGAVFDTVITLEANDISPQVTWGTNPGQVLPVNSEvpdpesfadpvdKASAERAlaymglepGTPLkDIKV 339
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   380 G--LIGSCTNSSYEDMGRSAAVAK-QALAHGLQCksqfTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWD 456
Cdd:TIGR00170 340 DkvFIGSCTNSRIEDLRAAAAVIKgRKVADNVKA----LVVPGSGLVKLQAEKEGLDKIFIEAGFEWREPGCSMCLGMNN 415
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*..
gi 27806769   457 RKdIKKGEKntIVTSYNRNFTGRNDANPETHafVTSPEIVTALAIAG 503
Cdd:TIGR00170 416 DR-LPEGER--CASTSNRNFEGRQGRGGRTH--LVSPAMAAAAAIHG 457
AcnA_Bact_Swivel cd01579
Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) ...
587-726 2.12e-28

Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism. This distinct subfamily is found only in bacteria and archea. Its exact characteristics are not known.


Pssm-ID: 238811 [Multi-domain]  Cd Length: 121  Bit Score: 109.83  E-value: 2.12e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 587 KVKGKCTTDHISAAGP-WLKFRGHLDNISNNLLIGainvengkansvrnaVTQEFGPvpdtaryYKKHGIRWVVIGDENY 665
Cdd:cd01579   1 KVGDNITTDHIMPAGAkVLPLRSNIPAISEFVFHR---------------VDPTFAE-------RAKAAGPGFIVGGENY 58
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27806769 666 GEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTI 726
Cdd:cd01579  59 GQGSSREHAALAPMYLGVRAVLAKSFARIHRANLINFGILPLTFADEDDYDRFEQGDQLEL 119
PRK12466 PRK12466
isopropylmalate isomerase large subunit; Provisional
227-505 9.99e-28

isopropylmalate isomerase large subunit; Provisional


Pssm-ID: 183543 [Multi-domain]  Cd Length: 471  Bit Score: 117.31  E-value: 9.99e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  227 PKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY 306
Cdd:PRK12466 165 PKTMRVRVDGELPPGVTAKDLILALIARIGADGATGYAIEFAGEAIRALSMEGRMTLCNMAVEAGARGGLIAPDETTFDY 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  307 LSKTGRADIANLADEFKDH---LVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKE------------ 371
Cdd:PRK12466 245 LRGRPRAPKGALWDAALAYwrtLRSDADAVFDREVEIDAADIAPQVTWGTSPDQAVPITGRVPDPAAEadparraamera 324
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  372 --------GWPL-DIRVG--LIGSCTNSSYEDM--------GRSAAVAKQALahglqcksqftITPGSEQIRATIERDGY 432
Cdd:PRK12466 325 ldymgltpGTPLaGIPIDrvFIGSCTNGRIEDLraaaavlrGRKVAPGVRAM-----------VVPGSGAVRRQAEAEGL 393
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 27806769  433 AQILRDVGGIVLANACGPCIGQWDRKdIKKGEKntIVTSYNRNFTGRNDANPETHafVTSPEIVTALAIAGTL 505
Cdd:PRK12466 394 ARIFIAAGFEWREPGCSMCLAMNDDV-LAPGER--CASTTNRNFEGRQGPGARTH--LMSPAMVAAAAVAGHI 461
PRK11413 PRK11413
putative hydratase; Provisional
89-773 5.77e-24

putative hydratase; Provisional


Pssm-ID: 183125 [Multi-domain]  Cd Length: 751  Bit Score: 107.79  E-value: 5.77e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   89 LRLRPDRVAMRDAT----AQMAmlqfISSGLPKVAVPSTIHCDHLIEAQLGGEkdlrrakdINQEVYNFLATAGAKYGVG 164
Cdd:PRK11413  54 LKIKFDSLASHDITfvgiIQTA----KASGMERFPLPYVLTNCHNSLCAVGGT--------INEDDHVFGLSAAQKYGGI 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  165 FWRPGSGIIHQIILENYAYPGVLLIGTDSHTpnggglggicigvgGADAVDVTA---GIP----------WELKCPKVIG 231
Cdd:PRK11413 122 FVPPHIAVIHQYMREMMAGGGKMILGSDSHT--------------RYGALGTMAvgeGGGelvkqllndtYDIDYPGVVA 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  232 VKLTGSLSGWTSPKDVILKVAGILTVKGGT-GAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKT 310
Cdd:PRK11413 188 VYLTGKPAPGVGPQDVALAIIGAVFKNGYVkNKVMEFVGPGVSALSTDFRNGVDVMTTETTCLSSIWQTDEEVHNWLALH 267
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  311 GRadianlADEFKDhLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVA-------EKEGWPLD------- 376
Cdd:PRK11413 268 GR------GQDYCE-LNPQPMAYYDGCISVDLSAIKPMIALPFHPSNVYEIDELNQNLtdilrevEIESERVAhgkakls 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  377 ---------IRV--GLIGSCTNSSYEDMGRSAAVAKqalahGLQCKS-QFTIT--PGSEQIRATIERDGYAQILRDVGGI 442
Cdd:PRK11413 341 lldkiengrLKVqqGIIAGCSGGNYENVIAAANALR-----GQSCGNdTFSLSvyPSSQPVFMDLAKKGVVADLMGAGAI 415
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  443 VLANACGPCIGQWDrkdikkgekntivTSYN---------RNFTGRNDANPeTHAFVTSPEIVTALAIAGTLKFNpetDF 513
Cdd:PRK11413 416 IRTAFCGPCFGAGD-------------TPANnglsirhttRNFPNREGSKP-ANGQMSAVALMDARSIAATAANG---GY 478
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  514 LTGKDgkkfklEAPDADELPRAEFDPgqDTYQHPPKDSSGQQVdvspTSQRLQLLEPFDKWDgrDLEDL--QILIKVKGK 591
Cdd:PRK11413 479 LTSAT------ELDCWDNVPEYAFDV--TPYKNRVYQGFGKGA----TQQPLIYGPNIKDWP--EMGALtdNILLKVCSK 544
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  592 -----CTTDHISAAGPWLKFRghldniSNNLLIGAIN--------VENGKA-----NSVRNAVTQEFGPVPDTAR-YYKK 652
Cdd:PRK11413 545 ildpvTTTDELIPSGETSSYR------SNPLGLAEFTlsrrdpgyVGRSKAvaeleNQRLAGNVSELTEVFARIKqIAGQ 618
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  653 HGIRW--VVIGDENY----GEGSSREHAALEPRHLGGRAIITKSFA-RIHETNLKKQGLLPLTFADPadyNKIHPVDKLT 725
Cdd:PRK11413 619 EHIDPlqTEIGSMVYavkpGDGSAREQAASCQRVLGGLANIAEEYAtKRYRSNVINWGMLPFQMAEE---PTFEVGDYIY 695
                        730       740       750       760       770
                 ....*....|....*....|....*....|....*....|....*....|.
gi 27806769  726 IKGLKDFAPGKPLTC---IIKHPNGTQETILLNHTFNETQIEWFRAGSALN 773
Cdd:PRK11413 696 IPGIRAALDNPGTTFkgyVIHEDAPVTEITLYMESLTAEEREIIKAGCLIN 746
AcnA_IRP_Swivel cd01580
Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, ...
593-728 4.41e-19

Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238812 [Multi-domain]  Cd Length: 171  Bit Score: 85.02  E-value: 4.41e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 593 TTDHISAAGPWLK-------------------------------FRGHLDNISN-NLLigainVENGKANSVRNAVTQEF 640
Cdd:cd01580   7 TTDHISPAGSIAKdspagkylaergvkprdfnsygsrrgndevmMRGTFANIRLrNKL-----VPGTEGGTTHHPPTGEV 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 641 GPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADP--ADYNKI 718
Cdd:cd01580  82 MSIYDAAMRYKEEGVPLVILAGKEYGSGSSRDWAAKGPFLLGVKAVIAESFERIHRSNLVGMGILPLQFPPGenADSLGL 161
                       170
                ....*....|
gi 27806769 719 HPVDKLTIKG 728
Cdd:cd01580 162 TGEETYDIIG 171
IPMI_Swivel cd01577
Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized ...
658-726 1.05e-13

Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238809 [Multi-domain]  Cd Length: 91  Bit Score: 66.84  E-value: 1.05e-13
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYN-KIHPVDKLTI 726
Cdd:cd01577  20 IIVAGKNFGCGSSREHAPWALKDAGIRAVIAESFARIFFRNAINNGLLPVTLADEDVEEvEAKPGDEVEV 89
LeuD COG0066
3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];
658-726 2.94e-11

3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];


Pssm-ID: 223144 [Multi-domain]  Cd Length: 191  Bit Score: 62.99  E-value: 2.94e-11
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27806769 658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPA--DYNKIHPVDKLTI 726
Cdd:COG0066  65 ILVAGENFGCGSSREHAPWALKDYGIRAVIAPSFADIFYRNAINNGLLPIVLAEEDvtELFEDVPGDEVTV 135
AcnB cd01581
Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA ...
162-505 3.58e-10

Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle; Aconitase B catalytic domain. Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase has an active (4FE-4S) and an inactive (3FE-4S) form. The active cluster is part of the catalytic site that interconverts citrate, cis-aconitase and isocitrate. The domain architecture of aconitase B is different from other aconitases in that the catalytic domain is normally found at C-terminus for other aconitases, but it is at N-terminus for B family. It also has a HEAT domain before domain 4 which plays a role in protein-protein interaction. This alignment is the core domain including domains 1,2 and 3.


Pssm-ID: 153131  Cd Length: 436  Bit Score: 62.52  E-value: 3.58e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 162 GVGFWRPGSGIIHQIiLENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVdVTAGIPweLKCPKVIGVKLTGSLSGW 241
Cdd:cd01581  85 GGVALRPGDGVIHSW-LNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAA-ATGVMP--LDMPESVLVRFKGKMQPG 160
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 242 TSPKDVILKV------AGILTV--KGG----TGAIVEYHGpgVDSISCTGMATICNMGAEIGATTSVFPYNH-------- 301
Cdd:cd01581 161 ITLRDLVNAIpyyaiqQGLLTVekKGKknvfNGRILEIEG--LPDLKVEQAFELTDASAERSAAACTVRLDKepvieyle 238
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 302 ----RMKKYLSKtGRADIANLADEFKDH---------LVPDSGCHYDQLIEINLSELK-PHINGPFTPDlahpvaEVGSV 367
Cdd:cd01581 239 snvvLMKIMIAN-GYDDARTLLRRIIAMeewlanpplLEPDADAEYAAVIEIDLDDIKePILACPNDPD------DVKLL 311
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 368 AEKEGWPLDIrvGLIGSC-TNssyedMGRSAAVAKQALAHGlQCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLAN 446
Cdd:cd01581 312 SEVAGKKIDE--VFIGSCmTN-----IGHFRAAAKILRGKE-FKPTRLWVAPPTRMDWAILQEEGYYSIFGDAGARTEMP 383
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27806769 447 ACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGR--NDANpethAFVTSPEIVTALAIAGTL 505
Cdd:cd01581 384 GCSLCMGNQAR--VADGA--TVFSTSTRNFDNRvgKGAE----VYLGSAELAAVCALLGRI 436
AcnB COG1049
Aconitase B [Energy production and conversion];
152-505 4.37e-10

Aconitase B [Energy production and conversion];


Pssm-ID: 223978  Cd Length: 852  Bit Score: 63.23  E-value: 4.37e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 152 NFLATAGakyGVGFwRPGSGIIHQIiLENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVdVTAGIPweLKCPKVIG 231
Cdd:COG1049 453 DFIMNRG---GVSL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAA-ATGVMP--LDMPESVL 524
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 232 VKLTGSLSGWTSPKDVILKVA------GILTVKGG------TGAIVEYHGPG---VD--------SISCTGMATICNMGA 288
Cdd:COG1049 525 VRFKGEMQPGITLRDLVHAIPyyaikqGLLTVEKKgkknifSGRILEIEGLPdlkVEqafeltdaSAERSAAGCTIKLNK 604
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 289 EigattSVFPY---NHRMKKYLSKTGRADIANL------ADEFKDH---LVPDSGCHYDQLIEINLSELK-PHINGPFTP 355
Cdd:COG1049 605 E-----PIIEYlksNIVLLKWMIAEGYGDARTLerridkMEAWLANpelLEADADAEYAAVIEIDLADIKePILAAPNDP 679
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769 356 DLAHPVAEVgsvaekEGWPLDIrvGLIGSC-TNssyedMGRSAAVAKQALAHGLQCKSQFTITPGSEQIRATIERDGYAQ 434
Cdd:COG1049 680 DDVRLLSEV------AGDKIDE--VFIGSCmTN-----IGHFRAAGKLLENAKGELPTRLWVAPPTKMDAAQLTEEGYYS 746
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 27806769 435 ILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGR--NDANpethAFVTSPEIVTALAIAGTL 505
Cdd:COG1049 747 IFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKGAN----VYLASAELAAVCAILGKI 811
PLN00094 PLN00094
aconitate hydratase 2; Provisional
152-505 6.43e-10

aconitate hydratase 2; Provisional


Pssm-ID: 215053  Cd Length: 938  Bit Score: 62.63  E-value: 6.43e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  152 NFLATAGakyGVGFwRPGSGIIHQIiLENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVdVTAGIPweLKCPKVIG 231
Cdd:PLN00094 525 DFIRNRG---GVSL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFGA-ATGVIP--LDMPESVL 596
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  232 VKLTGSLSGWTSPKDVILKV------AGILTV-KGG-----TGAIVEYHGpgVDSISCTGMATICNMGAEIGAT------ 293
Cdd:PLN00094 597 VRFTGTMQPGITLRDLVHAIpytaiqDGLLTVeKKGkknvfSGRILEIEG--LPHLKCEQAFELSDASAERSAAgctikl 674
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  294 --TSVFPY---NHRMKKYLSKTGRAD-------IANLADEFKD-HLV-PDSGCHYDQLIEINLSELK-PHINGPFTPDLA 358
Cdd:PLN00094 675 dkEPIIEYlnsNVVMLKWMIAEGYGDrrtlerrIARMQQWLADpELLeADPDAEYAAVIEIDMDEIKePILCAPNDPDDA 754
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  359 HPVAEVgsVAEKegwpldIRVGLIGSC-TNssyedMGRSAAVAKQALAHGLQCKSQFTITPGSEQIRATIERDGYAQILR 437
Cdd:PLN00094 755 RLLSEV--TGDK------IDEVFIGSCmTN-----IGHFRAAGKLLNDNLSQLPTRLWVAPPTKMDEAQLKAEGYYSTFG 821
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  438 DVGGIVLANACGPCIGQWDRkdikKGEKNTIVTSYNRNFTGR--NDANpethAFVTSPEIVTALAIAGTL 505
Cdd:PLN00094 822 TVGARTEMPGCSLCMGNQAR----VAEKSTVVSTSTRNFPNRlgKGAN----VYLASAELAAVAAILGRL 883
acnB TIGR00117
aconitate hydratase 2; Aconitate hydratase (aconitase) is an enzyme of the TCA cycle. This ...
152-505 1.39e-09

aconitate hydratase 2; Aconitate hydratase (aconitase) is an enzyme of the TCA cycle. This model describes aconitase 2, AcnB, which has weak similarity to aconitase 1. It is found almost exclusively in the Proteobacteria. [Energy metabolism, TCA cycle]


Pssm-ID: 129223  Cd Length: 844  Bit Score: 61.46  E-value: 1.39e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   152 NFLATAGakyGVGFwRPGSGIIHQIiLENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVdVTAGIPweLKCPKVIG 231
Cdd:TIGR00117 452 DFIMNRG---GVAL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFAA-ATGVMP--LDMPESVL 523
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   232 VKLTGSLSGWTSPKDVILKV------AGILTV-KGG-----TGAIVEYHGpgVDSISCTGMATICNMGAEIGATTSVFPY 299
Cdd:TIGR00117 524 VRFKGEMQPGITLRDLVNAIplyaikQGLLTVeKKGkknvfNGRILEIEG--LPDLKVEQAFELTDASAERSAAGCTIKL 601
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   300 NHR-MKKYLSKTGRADIANLADEFKDH-------------------LVPDSGCHYDQLIEINLSELK-PHINGPFTPDLA 358
Cdd:TIGR00117 602 NKEpIIEYLNSNIVLLKWMIAEGYGDRrtlerriqgmekwlanpelLEADADAEYAAVIEIDLAEIKePILAAPNDPDDV 681
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769   359 HPVAEVGSVAEKEGWpldirvglIGSC-TNssyedMGRSAAVAKQALAHGlQCKSQFTITPGSEQIRATIERDGYAQILR 437
Cdd:TIGR00117 682 RPLSEVQGDKIDEVF--------IGSCmTN-----IGHFRAAGKILDAAG-QLPTRLWVAPPTRMDEQQLTEEGYYSIFG 747
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 27806769   438 DVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGRNDANPEThaFVTSPEIVTALAIAGTL 505
Cdd:TIGR00117 748 AAGARTEIPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRMGTGANV--YLGSAELAAVCALLGKI 809
leuD PRK00439
3-isopropylmalate dehydratase small subunit; Reviewed
658-726 2.60e-09

3-isopropylmalate dehydratase small subunit; Reviewed


Pssm-ID: 234762 [Multi-domain]  Cd Length: 163  Bit Score: 56.76  E-value: 2.60e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 27806769  658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADynKIHPVDKLTI 726
Cdd:PRK00439  51 IIVAGKNFGCGSSREHAPIALKAAGVSAVIAKSFARIFYRNAINIGLPVLECDEAVD--KIEDGDEVEV 117
PRK14023 PRK14023
homoaconitate hydratase small subunit; Provisional
644-714 9.92e-09

homoaconitate hydratase small subunit; Provisional


Pssm-ID: 184460 [Multi-domain]  Cd Length: 166  Bit Score: 55.19  E-value: 9.92e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 27806769  644 PDTARYYKKHGIrwvVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPAD 714
Cdd:PRK14023  41 PEFASTVRPGDI---LVAGRNFGLGSSREYAPEALKMLGIGAIIAKSYARIFYRNLVNLGIPPFESEEVVD 108
LEUD_arch TIGR02087
3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the ...
658-707 4.95e-08

3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the 3-isopropylmalate dehydratase, small subunits which form TIGR00171. This subfamily includes the members of TIGR02084 which are gene clustered with other genes of leucine biosynthesis. The rest of the subfamily includes mainly archaeal species which exhibit two hits to this model. In these cases it is possible that one or the other of the hits does not have a 3-isopropylmalate dehydratase activity but rather one of the other related aconitase-like activities.


Pssm-ID: 273961 [Multi-domain]  Cd Length: 154  Bit Score: 52.81  E-value: 4.95e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 27806769   658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPL 707
Cdd:TIGR02087  50 VIVAGKNFGCGSSREQAALALKAAGIAAVIAESFARIFYRNAINIGLPLI 99
leuD PRK01641
isopropylmalate isomerase small subunit; Provisional
658-726 2.21e-07

isopropylmalate isomerase small subunit; Provisional


Pssm-ID: 179314 [Multi-domain]  Cd Length: 200  Bit Score: 51.67  E-value: 2.21e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27806769  658 VVIGDENYGEGSSREHA--ALEprHLGGRAIITKSFARIHETNLKKQGLLPLTfADPADYNKI------HPVDKLTI 726
Cdd:PRK01641  70 ILLAGDNFGCGSSREHApwALA--DYGFRAVIAPSFADIFYNNCFKNGLLPIV-LPEEDVDELfklveaNPGAELTV 143
PRK09238 PRK09238
bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated
326-505 2.86e-07

bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated


Pssm-ID: 236424  Cd Length: 835  Bit Score: 54.03  E-value: 2.86e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  326 LVPDSGCHYDQLIEINLSELK-PHINGPFTPDLAHPVAEVGsvAEKegwpldIRVGLIGSC-TNssyedMGRSAAVAKQA 403
Cdd:PRK09238 647 LEADADAEYAAVIEIDLAEIKePILACPNDPDDVRLLSEVA--GTK------IDEVFIGSCmTN-----IGHFRAAGKLL 713
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27806769  404 LAHGLQCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRkdIKKGEknTIVTSYNRNFTGR--ND 481
Cdd:PRK09238 714 EGKKGQLPTRLWVAPPTKMDADQLTEEGYYSIFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKG 789
                        170       180
                 ....*....|....*....|....
gi 27806769  482 ANpethAFVTSPEIVTALAIAGTL 505
Cdd:PRK09238 790 AN----VYLGSAELAAVCALLGRI 809
leud TIGR02084
3-isopropylmalate dehydratase, small subunit; Homoaconitase, aconitase, and 3-isopropylmalate ...
658-704 2.83e-06

3-isopropylmalate dehydratase, small subunit; Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The members of the seed for this model are those sequences which are gene clustered with other genes involved in leucine biosynthesis and include some archaea. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 131139 [Multi-domain]  Cd Length: 156  Bit Score: 47.86  E-value: 2.83e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 27806769   658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGL 704
Cdd:TIGR02084  50 IIVAGENFGCGSSREHAPIAIKASGISCVIAKSFARIFYRNAINIGL 96
PLN00072 PLN00072
3-isopropylmalate isomerase/dehydratase small subunit; Provisional
658-694 1.83e-05

3-isopropylmalate isomerase/dehydratase small subunit; Provisional


Pssm-ID: 177701 [Multi-domain]  Cd Length: 246  Bit Score: 46.78  E-value: 1.83e-05
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 27806769  658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARI 694
Cdd:PLN00072 132 IIIGGENFGCGSSREHAPVALGAAGAKAVVAESYARI 168
leuD TIGR00171
3-isopropylmalate dehydratase, small subunit; Homoaconitase, aconitase, and 3-isopropylmalate ...
658-711 7.45e-05

3-isopropylmalate dehydratase, small subunit; Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The candidate archaeal leuD proteins are not included in the seed alignment for this model and score below the trusted cutoff. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 129275 [Multi-domain]  Cd Length: 188  Bit Score: 44.04  E-value: 7.45e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 27806769   658 VVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFAD 711
Cdd:TIGR00171  72 ILLARENFGCGSSREHAPWALDDYGFKVIIAPSFADIFYNNSFKNGLLPIRLSY 125
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH