NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|29789421|ref|NP_780525|]
View 

solute carrier organic anion transporter family member 2B1 isoform 2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS super family cl28910
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
40-577 0e+00

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


The actual alignment was detected with superfamily member cd17460:

Pssm-ID: 421695 [Multi-domain]  Cd Length: 479  Bit Score: 696.90  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17460   1 IKFFVLCHGLLQLSQLLVSGYLKSSISTIEKRFGLSSQTSGLLASFNEVGNTVLIVFVSYFGSRVHRPRFIGCGAILVSL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYdhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17460  81 AGFLMALPHFISEPYEY---------------------------------------------GILFLGQLLLGIGGVPIQ 115
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17460 116 PFGISYIDDFASESNSPLYLGILFAVTVLGPGFGFMLGSAMLRFYVDIDKMSEDEISLEIGDPRWVGAWWLGFLIAATLV 195
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPREMPKEKHEFHFRRKVLASaastaskgedlssqhEPLKKQAGLAQIAPDLTLVQFVKVFPRVLLRNLRH 359
Cdd:cd17460 196 ALSAVPYFFFPREMPKEVVELQPREKKLAK---------------TMLKKLKSLSDILQNLSLLQFIKKFPRILLRTLRN 260
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17460 261 PIYLLVVLAQVNLSAMVAGLATFMGKFLERQFSITASFANLMIGGLNIPSAMVGIVVGGVILKRLQLTVRGCGAMCVLGM 340
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCtGRVVQEALG 519
Cdd:cd17460 341 LLCLFFALPLLFIGCSTQKIAGITHRTSSSPGLELSSQCSEACSCPPEAFNPVCGSDG-VEYISPCHAGC-KSVNVQALD 418
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29789421 520 KSQVFYTNCSCVAGNGTVPAGS---CESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17460 419 NSVVNYTDCSCVSEGGPVGAASpgtCGSGCSHLLVPFMLLVSLGGFLASLSHTPSFMLILR 479
 
Name Accession Description Interval E-value
MFS_SLCO2B_OATP2B cd17460
Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of ...
40-577 0e+00

Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2B (SLCO2B), also called Organic anion-transporting polypeptide 2B (OATP2B), subfamily has one mammalian member, OATP2B1 (encoded by SLCO2B1). It mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. It also mediates the transport of endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). SLCO2B1 variations result in differential expression and uptake of DHEAS, which impacts subsequent resistance to androgen-deprivation therapy (ADT), the primary treatment of metastatic prostate cancer. The SLCO2B/OATP2B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341018 [Multi-domain]  Cd Length: 479  Bit Score: 696.90  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17460   1 IKFFVLCHGLLQLSQLLVSGYLKSSISTIEKRFGLSSQTSGLLASFNEVGNTVLIVFVSYFGSRVHRPRFIGCGAILVSL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYdhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17460  81 AGFLMALPHFISEPYEY---------------------------------------------GILFLGQLLLGIGGVPIQ 115
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17460 116 PFGISYIDDFASESNSPLYLGILFAVTVLGPGFGFMLGSAMLRFYVDIDKMSEDEISLEIGDPRWVGAWWLGFLIAATLV 195
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPREMPKEKHEFHFRRKVLASaastaskgedlssqhEPLKKQAGLAQIAPDLTLVQFVKVFPRVLLRNLRH 359
Cdd:cd17460 196 ALSAVPYFFFPREMPKEVVELQPREKKLAK---------------TMLKKLKSLSDILQNLSLLQFIKKFPRILLRTLRN 260
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17460 261 PIYLLVVLAQVNLSAMVAGLATFMGKFLERQFSITASFANLMIGGLNIPSAMVGIVVGGVILKRLQLTVRGCGAMCVLGM 340
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCtGRVVQEALG 519
Cdd:cd17460 341 LLCLFFALPLLFIGCSTQKIAGITHRTSSSPGLELSSQCSEACSCPPEAFNPVCGSDG-VEYISPCHAGC-KSVNVQALD 418
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29789421 520 KSQVFYTNCSCVAGNGTVPAGS---CESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17460 419 NSVVNYTDCSCVSEGGPVGAASpgtCGSGCSHLLVPFMLLVSLGGFLASLSHTPSFMLILR 479
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
42-636 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 619.22  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    42 FFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVATAG 121
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   122 LLMALPHFISEPyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvgiMFAAQTLLGIGGVPIQPF 201
Cdd:pfam03137  81 LLFALPHFLSGP--------------------------------------------------FFLGQLLLGIGGTPLYTL 110
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   202 GISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPeggINLTPKDPRWVGAWWLGFLISSGLVVL 281
Cdd:pfam03137 111 GISYIDDNVKKKNSPLYIGILYAVRVLGPALGFLLGSLCLRIYVDIGSVS---LTLTPKDPRWVGAWWLGFLIAGLLLLL 187
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   282 ASSPYFFFPREMPKEKHEFHFRRKVLASAASTASKGEDLSsqheplkkqaglaqiapdLTLVQFVKVFPRVLLRNLRHPI 361
Cdd:pfam03137 188 TAIPFFFFPKSLPGTAKRRAEKKKERESHHSIKDKEKTKS------------------LKLGKSLKDFPKALKRLLKNPV 249
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   362 FLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGSLL 441
Cdd:pfam03137 250 YMLLTLASVSEFLLIAGYATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLV 329
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   442 CLLFSVPLFFIGCSTHQIAGITQDLGA--QPGPSLFPGCSEPCSCQSDDFNPVCDtSAYVEYTTPCHAGCTGRVVQEALG 519
Cdd:pfam03137 330 SLLLSLLLFFLGCPNSPVAGITVPYGGtqQLSGNLTASCNSNCSCSSSFYSPVCG-SDGIGYTSPCPCGAGCSSSSGAGK 408
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   520 KSQVFYTNCSCVA----GNGTVPAGSCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILRGVKKEDKTLAVGMQFMLL 595
Cdd:pfam03137 409 STYNCSCCCSCGSsdsgGNGSATPGKCPSDCSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLIL 488
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|.
gi 29789421   596 RVLAWMPSPVIHGSAIDTTCVHWALTCGRRAVCRYYDHDLL 636
Cdd:pfam03137 489 RLLGFIPGPIIFGALIDSTCLLWTKTCGGRGNCWLYDNDKL 529
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
15-663 1.28e-169

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 499.64  E-value: 1.28e-169
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    15 MHERKVSVEPQDSHQDAQPRG-----MFHNIKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVG 89
Cdd:TIGR00805   1 MGETEKDIATHESSAGLKPRPrclqsLFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    90 NVSLILFVSYFGSRVHRPRMIGYGALLVATAGLLMALPHFISEPYRYDHSSSDNRSLDFEAS-LCLpttMAPASALSNGS 168
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSANSfLCM---ENLTQTLRPTQ 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   169 CSSHTETKHLT-MVGIMFAAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDI 247
Cdd:TIGR00805 158 DPSECQKQHKSlMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDT 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   248 DRMPEGGINLTPKDPRWVGAWWLGFLISSGLVVLASSPYFFFPREMPKEkhefhfrrkvLASAASTASKGEDLSSQHEPL 327
Cdd:TIGR00805 238 GSVNTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKE----------GKRVNVDVHEAEKLEKSRGED 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   328 KKQaglaqiapdltLVQFVKVFPRVLLRNLRHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTI 407
Cdd:TIGR00805 308 RKK-----------NSGITKDFPKFIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNV 376
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   408 PLVIVGIMMGGVLVKRLHLSPVQCSALCLLGSLLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFP-GCSEPCSCQS 486
Cdd:TIGR00805 377 PPIGLGYLIGGFIMKKFKLNVKKAAYFAICLSTLEYLLYSPKFLITCESAPVAGVNNPSNDQPLYVENRtDCNRQCSCDS 456
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   487 DDFNPVCDTSAyVEYTTPCHAGCtgrvvQEALGK-SQVFYTNCSCVAGNGTVPA--GSCESACSRLVLPFIVLFSLGAGL 563
Cdd:TIGR00805 457 SIWDPVCGDNG-LAYLSPCHAGC-----RMSVGTgSNMVFTNCSCIQTPGNSSAkkGLCDPPCATSLQYFLILFIPLSFI 530
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   564 ASITHTPSFMLILRGVKKEDKTLAVGMQFMLLRVLAWMPSPVIHGSAIDTTCVHW-ALTCGRRAVCRYYDHDLLRNRFIG 642
Cdd:TIGR00805 531 YFITAVPGYMVLLRCVKSEERSLGLGLQWFCIRVFGTIPAPILFGALIDVTCLHWqTLKCGASGACRMYDNDNLRVIYLG 610
                         650       660
                  ....*....|....*....|.
gi 29789421   643 LQFFFKSGSLVCFTLVLAILR 663
Cdd:TIGR00805 611 LTIALRGSSLLPLFFILILAR 631
 
Name Accession Description Interval E-value
MFS_SLCO2B_OATP2B cd17460
Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of ...
40-577 0e+00

Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2B (SLCO2B), also called Organic anion-transporting polypeptide 2B (OATP2B), subfamily has one mammalian member, OATP2B1 (encoded by SLCO2B1). It mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. It also mediates the transport of endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). SLCO2B1 variations result in differential expression and uptake of DHEAS, which impacts subsequent resistance to androgen-deprivation therapy (ADT), the primary treatment of metastatic prostate cancer. The SLCO2B/OATP2B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341018 [Multi-domain]  Cd Length: 479  Bit Score: 696.90  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17460   1 IKFFVLCHGLLQLSQLLVSGYLKSSISTIEKRFGLSSQTSGLLASFNEVGNTVLIVFVSYFGSRVHRPRFIGCGAILVSL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYdhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17460  81 AGFLMALPHFISEPYEY---------------------------------------------GILFLGQLLLGIGGVPIQ 115
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17460 116 PFGISYIDDFASESNSPLYLGILFAVTVLGPGFGFMLGSAMLRFYVDIDKMSEDEISLEIGDPRWVGAWWLGFLIAATLV 195
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPREMPKEKHEFHFRRKVLASaastaskgedlssqhEPLKKQAGLAQIAPDLTLVQFVKVFPRVLLRNLRH 359
Cdd:cd17460 196 ALSAVPYFFFPREMPKEVVELQPREKKLAK---------------TMLKKLKSLSDILQNLSLLQFIKKFPRILLRTLRN 260
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17460 261 PIYLLVVLAQVNLSAMVAGLATFMGKFLERQFSITASFANLMIGGLNIPSAMVGIVVGGVILKRLQLTVRGCGAMCVLGM 340
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCtGRVVQEALG 519
Cdd:cd17460 341 LLCLFFALPLLFIGCSTQKIAGITHRTSSSPGLELSSQCSEACSCPPEAFNPVCGSDG-VEYISPCHAGC-KSVNVQALD 418
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29789421 520 KSQVFYTNCSCVAGNGTVPAGS---CESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17460 419 NSVVNYTDCSCVSEGGPVGAASpgtCGSGCSHLLVPFMLLVSLGGFLASLSHTPSFMLILR 479
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
42-636 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 619.22  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    42 FFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVATAG 121
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   122 LLMALPHFISEPyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvgiMFAAQTLLGIGGVPIQPF 201
Cdd:pfam03137  81 LLFALPHFLSGP--------------------------------------------------FFLGQLLLGIGGTPLYTL 110
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   202 GISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPeggINLTPKDPRWVGAWWLGFLISSGLVVL 281
Cdd:pfam03137 111 GISYIDDNVKKKNSPLYIGILYAVRVLGPALGFLLGSLCLRIYVDIGSVS---LTLTPKDPRWVGAWWLGFLIAGLLLLL 187
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   282 ASSPYFFFPREMPKEKHEFHFRRKVLASAASTASKGEDLSsqheplkkqaglaqiapdLTLVQFVKVFPRVLLRNLRHPI 361
Cdd:pfam03137 188 TAIPFFFFPKSLPGTAKRRAEKKKERESHHSIKDKEKTKS------------------LKLGKSLKDFPKALKRLLKNPV 249
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   362 FLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGSLL 441
Cdd:pfam03137 250 YMLLTLASVSEFLLIAGYATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLV 329
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   442 CLLFSVPLFFIGCSTHQIAGITQDLGA--QPGPSLFPGCSEPCSCQSDDFNPVCDtSAYVEYTTPCHAGCTGRVVQEALG 519
Cdd:pfam03137 330 SLLLSLLLFFLGCPNSPVAGITVPYGGtqQLSGNLTASCNSNCSCSSSFYSPVCG-SDGIGYTSPCPCGAGCSSSSGAGK 408
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   520 KSQVFYTNCSCVA----GNGTVPAGSCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILRGVKKEDKTLAVGMQFMLL 595
Cdd:pfam03137 409 STYNCSCCCSCGSsdsgGNGSATPGKCPSDCSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLIL 488
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|.
gi 29789421   596 RVLAWMPSPVIHGSAIDTTCVHWALTCGRRAVCRYYDHDLL 636
Cdd:pfam03137 489 RLLGFIPGPIIFGALIDSTCLLWTKTCGGRGNCWLYDNDKL 529
MFS_SLCO2_OATP2 cd17401
Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of ...
40-577 0e+00

Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2 (SLCO2) or Organic anion transporting polypeptide 2 (OATP2) family contains two subfamilies: OATP2A and OATP2B, each containing one mammalian member, OATP2A1 and OATP2B1, respectively. OATP2A1 (encoded by SLCO2A1) is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. OATP2B1 (encoded by SLCO2B1) mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost, as well as endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). The SLCO2/OATP2 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340959 [Multi-domain]  Cd Length: 440  Bit Score: 611.08  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17401   1 IKVFVLCHGLLQLCQLLYSGYLKSSITTIEKRFGLSSSSSGLLASFNEVGNTILIVFVSYFGSRVHRPRLIGIGGLFLAA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYdhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17401  81 GAFLLTLPHFISEPYQY---------------------------------------------GIMVVAQLLLGIGGVPIQ 115
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17401 116 PFGISYIDDFAEPSNSPLYLGILFAVTVFGPAFGYLLGSVMLRLYVDIGRMNTAAVNLVPGDPRWIGAWWLGFLIAAALL 195
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPRempkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvqFVKVFPRVLLRNLRH 359
Cdd:cd17401 196 VLTSFPYFFFPR-----------------------------------------------------FIKRFPCIFLRTLRN 222
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17401 223 PIFLLVVLAQVTLSSMIAGLATFLNKFLEKQFGTTASYANFLIGAVNLPSAALGILFGGVLMKRLVLSLQAIPAICTTII 302
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQEALG 519
Cdd:cd17401 303 TISMIFCVPLFFIGCSTPTIAGVYPPSSSSSIHPQSPACRRDCSCPDSIFNPVCGDNG-VEYLSPCHAGCSNINMSTSAT 381
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 29789421 520 KSQVFYTNCSCVAGNGTV-PAGSCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17401 382 SKQVIYTNCSCVTGGSASaKTGSCPSPCSHLLLPFIFLISLVSLIACLSHTPSFMMILR 440
MFS_SLCO2A_OATP2A cd17461
Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of ...
39-577 1.03e-176

Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2A (SLCO2A), also called Organic anion-transporting polypeptide 2A (OATP2A), subfamily has one mammalian member, OATP2A1 (encoded by SLCO2A1), which is also called prostaglandin transporter. It is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Mutations in SLCO2A1 can cause primary hypertrophic osteoarthropathy (PHO), a rare multi-organic disease characterized by digital clubbing, pachydermia and periosteal reaction. The SLCO2A/OATP2A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341019 [Multi-domain]  Cd Length: 474  Bit Score: 512.04  E-value: 1.03e-176
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  39 NIKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVA 118
Cdd:cd17461   1 NIKVFVLCHGLLQLSQLLYSAYFKSSLTTIEKRFGLSSLSSGLISSLHEIGNAVLIIFVSYFGSRVHRPRLIGIGGLLLA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 119 TAGLLMALPHFISEPYRYdhsssdnrsldfeaslclpttmapasalsngscsshtetkhlTMVGIMFAAQTLLGIGGVPI 198
Cdd:cd17461  81 LGAFLLTLPHFLSEPYQY------------------------------------------SMWVLMVVAQLLAGIGTVPI 118
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 199 QPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGL 278
Cdd:cd17461 119 QPFGISYVDDFAEPSNSPLYIAILFAISVFGPAFGYLLGSVVLRIFVDIGRVNTATVELTPADPRWIGAWWLGLLISSGL 198
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 279 VVLASSPYFFFPREMPKEKhefhfrrkvlasaaSTASKGEDLSSQHEPlKKQAGlaqiapdlTLVQFVKVFPRVLLRNLR 358
Cdd:cd17461 199 LVLTSLPYFFFPREMLVGK--------------KPSPEGDMLRKKEDE-KKEEG--------SLLDFIKRFPKMFVKLLL 255
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 359 HPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLG 438
Cdd:cd17461 256 NPLFMLLVLAQCTFSSVIAGLSTFLNKFLEKQYGASASYANFLIGAVNLPAAALGMLLGGIIMKRFGFSLRAIPRFSVVI 335
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 439 SLLCLLFSVPLFFIGCSTHQIAGI-TQDLGAQPGPSlfPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQEA 517
Cdd:cd17461 336 LSISIMLCVPLFFMGCSTQDVAGVyPKTSNSSDGPH--LSCSANCSCPESAFNPVCGENG-IEYISPCHAGCTNSNMDSS 412
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 29789421 518 LGKsQVFYTNCSCV---AGNGTVPAGSCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17461 413 TYR-QQIYSNCSCIpdlSGEKPAKTGSCPNSCSHLLLPVMFLISFAGLIACLTHNPLYMMVLR 474
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
15-663 1.28e-169

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 499.64  E-value: 1.28e-169
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    15 MHERKVSVEPQDSHQDAQPRG-----MFHNIKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVG 89
Cdd:TIGR00805   1 MGETEKDIATHESSAGLKPRPrclqsLFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    90 NVSLILFVSYFGSRVHRPRMIGYGALLVATAGLLMALPHFISEPYRYDHSSSDNRSLDFEAS-LCLpttMAPASALSNGS 168
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSANSfLCM---ENLTQTLRPTQ 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   169 CSSHTETKHLT-MVGIMFAAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDI 247
Cdd:TIGR00805 158 DPSECQKQHKSlMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDT 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   248 DRMPEGGINLTPKDPRWVGAWWLGFLISSGLVVLASSPYFFFPREMPKEkhefhfrrkvLASAASTASKGEDLSSQHEPL 327
Cdd:TIGR00805 238 GSVNTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKE----------GKRVNVDVHEAEKLEKSRGED 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   328 KKQaglaqiapdltLVQFVKVFPRVLLRNLRHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTI 407
Cdd:TIGR00805 308 RKK-----------NSGITKDFPKFIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNV 376
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   408 PLVIVGIMMGGVLVKRLHLSPVQCSALCLLGSLLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFP-GCSEPCSCQS 486
Cdd:TIGR00805 377 PPIGLGYLIGGFIMKKFKLNVKKAAYFAICLSTLEYLLYSPKFLITCESAPVAGVNNPSNDQPLYVENRtDCNRQCSCDS 456
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   487 DDFNPVCDTSAyVEYTTPCHAGCtgrvvQEALGK-SQVFYTNCSCVAGNGTVPA--GSCESACSRLVLPFIVLFSLGAGL 563
Cdd:TIGR00805 457 SIWDPVCGDNG-LAYLSPCHAGC-----RMSVGTgSNMVFTNCSCIQTPGNSSAkkGLCDPPCATSLQYFLILFIPLSFI 530
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   564 ASITHTPSFMLILRGVKKEDKTLAVGMQFMLLRVLAWMPSPVIHGSAIDTTCVHW-ALTCGRRAVCRYYDHDLLRNRFIG 642
Cdd:TIGR00805 531 YFITAVPGYMVLLRCVKSEERSLGLGLQWFCIRVFGTIPAPILFGALIDVTCLHWqTLKCGASGACRMYDNDNLRVIYLG 610
                         650       660
                  ....*....|....*....|.
gi 29789421   643 LQFFFKSGSLVCFTLVLAILR 663
Cdd:TIGR00805 611 LTIALRGSSLLPLFFILILAR 631
MFS_SLCO_OATP cd17336
Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; ...
40-577 5.44e-130

Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; Solute carrier organic anion transporters (SLCOs) are also called organic anion transporting polypeptides (OATPs) or SLC21 (Solute carrier family 21) proteins. They are sodium-independent transporters that mediate the transport of a broad range of endo- as well as xenobiotics. Their substrates are mainly amphipathic organic anions with a molecular weight of more than 300Da, although there are a few known neutral or positively charged substrates. These include drugs including statins, angiotensin-converting enzyme inhibitors, angiotensin receptor blockers, antibiotics, antihistaminics, antihypertensives, and anticancer drugs. SLCOs/OATPs can be classified into 6 families (SLCO1-6 or OATP1-6) and each family may have subfamilies (e.g. OATP1A, OATP1B, OATP1C). Within the subfamilies, individual members are numbered according to the chronology of their identification and if there is already an ortholog known, they are given the same number. For example, the first SLCO identified, is rat OATP1A1 (encoded by the Slco1a1 gene). The second SLCO identified is the first human SLCO from the same subfamily and is called OATP1A2 (encoded by the SLCO1A2 gene). There are 11 human SLCOs/OATPs. SLCOs belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340894 [Multi-domain]  Cd Length: 411  Bit Score: 390.06  E-value: 5.44e-130
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17336   1 PKVFVVLLCLLGLLQGAVVSYFVSTITTIEKRFGLSSSQSGLILSANDIGQLLAVLLVSYFGGRGHRPRWIGIGSILMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFisepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvgiMFAAQTLLGIGGVPIQ 199
Cdd:cd17336  81 GCFLLALPHF------------------------------------------------------LFVGQFLLGIGSSPLY 106
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPeggINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17336 107 TLGITYIDDNVSKKNSPLYIGILYAMRVLGPALGFLLGSFLLRIYVDFSRVP---LGITPDDPRWIGAWWLGFLILGILL 183
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPrempkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvqfvkvfprvllrnlrh 359
Cdd:cd17336 184 LIVSIPLFFFP--------------------------------------------------------------------- 194
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17336 195 PIFILLLLAIVFESFAISGFSTFLPKYLETQFRLSASLASLLTGLILVPGAALGILLGGLIIKKFKLTARGLAKFVLILS 274
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPgCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVvqeaLG 519
Cdd:cd17336 275 LLSVILYISLFFLGCDNPPIAGVTTPYGSSSSPITSS-CNSDCNCSDSSFSPVCGSDG-ITYFSPCHAGCTSSD----AG 348
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 29789421 520 KSQVFYTNCSCVAGN-----GTVPAGSCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17336 349 NGTKTYSNCSCINSGtatssGCPPDCSVAPNCCSKLIPFLAVLFLSSFLLSLSIVPSTMITLR 411
MFS_SLCO1C_OATP1C cd17459
Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of ...
40-577 3.62e-104

Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1C (SLCO1C), also called Organic anion-transporting polypeptide 1C (OATP1C), subfamily contains one mammalian member, OATP1C1 (encoded by SLCO1C1), which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine), as well as organic anions such as 17-beta-glucuronosyl estradiol, estrone-3-sulfate, and sulfobromophthalein (BSP), which are transported with much lower efficiency. The SLCO1C/OATP1C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341017 [Multi-domain]  Cd Length: 498  Bit Score: 326.34  E-value: 3.62e-104
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17459   1 LKIFLAALSFAYFAKALSGSYMKSTITQIERRFDIPSSLIGVIDGSFEMGNLLVIAFVSYFGAKLHRPRIIGAGCLLMAI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYDHSSSDNRSLDFEASLCLPTTMAPASALSNGSCSSHTETKH---LTMVGIMFAAQTLLGIGGV 196
Cdd:cd17459  81 GTFLIALPHFFMGRYKYETAIQSSSNSTVSISPCSLEPSPQLHSIESSDSKTGTGCEKepgSSMWIYVFLGNLLRGIGET 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 197 PIQPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISS 276
Cdd:cd17459 161 PVQPLGISYIDDFAKEENAAFYIGCVQTIAIIGPVFGFLLGSLCAKLYVDIGFVNLDSITITPKDARWVGAWWLGYLIAG 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 277 GLVVLASSPYFFFPREMPKEkhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvqfvkvFPRVLLRN 356
Cdd:cd17459 241 VITLLSAVPFWFLPKSLPKD----------------------------------------------------FLPSLKNL 268
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 357 LRHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCL 436
Cdd:cd17459 269 LGNPVYFLYLCTSILQFNSLIGMVTYKPKYIEQQYGQSASKANFLIGLINIPAVAIGIFSGGLLMKKFKLSVIGAAKLSF 348
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 437 LGSLLCLLFSVPLFFIGCSTHQIAGITQDLGAQP-----GPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTg 511
Cdd:cd17459 349 GTSFFGYLLLLSFFAMGCENSDVAGLTVSYNGTKqvsyaDRSLFSQCNADCKCSQKDWDPVCGENG-ITYVSPCLAGCK- 426
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 29789421 512 rvVQEALGKSQVFYtNCSCV------AGNGTVPAGSCE--SACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17459 427 --ASNGSGKNTVFH-NCSCIgipssaSGSSSAILGQCPkgNACARMFLYFLAISVISSFTLSLGGTPGYILLIR 497
MFS_SLCO1A_OATP1A cd17458
Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of ...
40-577 3.66e-102

Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1A (SLCO1A), also called Organic anion-transporting polypeptide 1A (OATP1A), subfamily is composed of one human member OATP1A2 (encoded by SLCO1A2) and several rodent proteins encoded by the Slco1a1, Slco1a3, Slco1a4, Slco1a5, and Slco1a6 genes. OATP1A2, also known as human OATP-A or OATP1, shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). It is expressed in the brain, kidney, intestine, liver, lung, testes, and the eye (ciliary body). The SLCO1A/OATP1A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341016 [Multi-domain]  Cd Length: 527  Bit Score: 322.19  E-value: 3.66e-102
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17458   2 LKIFLLALSYAYVAKTLSGAYMNSMITQIERRFNIPSSLVGIINGSFEIGNLLVIAFVSYFGAKLHRPKVIGLGCLIMSL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYDHSSSDNRSLDFEASLCLPT-TMAPASALSNGSCSShtETKHLTMVGIMfAAQTLLGIGGVPI 198
Cdd:cd17458  82 GCFLASLPHFLMGRYEYESTVSTTSNSSSRVPLCLANqSLSHNVTQLPSECEK--ESMSLMWIFVL-VGNLLRGIGETPV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 199 QPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGL 278
Cdd:cd17458 159 MPLGISYIDDFSKKENSPFYIGCLHTATIVGPLLGLLLASFCAQLYVDLGSVNADDLTITPTDIRWVGAWWLGFLICAGV 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 279 VVLASSPYFFFPREMPKEKHEFHfrrkvlaSAASTASKGEDLSSQHEPLKKQagLAQIAPDltLVQFVKvfprVLLRNlr 358
Cdd:cd17458 239 NFLAGLPFWFLPKSLPKEGEENE-------TEPSKTLTVELEENKGQETKQE--MYEIAKD--FLPFLK----SLFRN-- 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 359 hPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLG 438
Cdd:cd17458 302 -PIYMLFIIVTVLQFNAFSGMISFMPKYLEQQYGKSASDAIFLIGVYNLPIICLGYFFGGLYMKKFKINTYQAAHIGFWV 380
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 439 SLLCLLFSVPLFFIGCSTHQIAGIT-------QDLGAQpgPSLFPGCSEPCSCQSDDFNPVCDTSAYVeYTTPCHAGCTG 511
Cdd:cd17458 381 SLLEYLLYFSAFWMGCDNSPVAGLTvsyegidQDSYYE--NTLLADCNRDCDCPLKVWDPVCGNNGLT-YVSACLAGCKA 457
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 29789421 512 RVvqeALGKSQVFyTNCSCVAG-----NGTVPAGSC--ESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17458 458 SV---GTGKNMVF-QNCSCVAAsgfpsQNSSAVGQCdkGETCDKMLQYFLILSLVCSFIFSLAAMPGYMVLIR 526
MFS_SLCO4_OATP4 cd17403
Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of ...
40-557 1.41e-97

Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4 (SLCO4) or Organic anion transporting polypeptide 4 (OATP4) family contains two families: OATP4A and OATP4C, each containing one mammalian member, OATP4A1 and OATP4C1, respectively. OATP4A1 (encoded by SLCO4A1), is ubiquitously expressed and mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4C1 (encoded by SLCO4C1) is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate, cAMP, and uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs). The SLCO4/OATP4 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340961 [Multi-domain]  Cd Length: 420  Bit Score: 306.49  E-value: 1.41e-97
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMI-SGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVA 118
Cdd:cd17403   1 PKGFLFFLCIFAFLQGMVvNGFVNVSITTIEKRFGLTSTQTGLIASSYDIASVLLLLFVSYFGGRGHKPRWLGIGAFIMG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 119 TAGLLMALPHFIsepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvgIMFAAQTLLGIGGVPI 198
Cdd:cd17403  81 IGSLVFALPHFT----------------------------------------------------VFILAQLLHGAGATPL 108
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 199 QPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRmPEGGINLTPKDPRWVGAWWLGFLISSGL 278
Cdd:cd17403 109 YTLGVTYLDENVSTKMSPLYIGIFYAMAILGPAIGYVLGGFLLNLYTDIDQ-VDSELGLTPDDPRWVGAWWLGFLISGAL 187
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 279 VVLASSPYFFFPrempkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvqfvkvfprvllrnlr 358
Cdd:cd17403 188 ALIIAFPLLGFP-------------------------------------------------------------------- 199
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 359 hPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLG 438
Cdd:cd17403 200 -PTFMFLNLAGASEGMLLAGFATFLPKLIESQFSLSASLAALLVGVVVVPGGILGTFLGGLIVKKLKLKCKGILKFCIVC 278
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 439 SLLCLLFSvPLFFIGCSTHQIAGIT---QDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQ 515
Cdd:cd17403 279 SIVAFLFS-FILLIYCPNAPFAGVTvpyGNSPLEGTSNLTSTCNADCHCSEDFYDPVCGSDG-VTYYSPCHAGCTTSHGD 356
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*....
gi 29789421 516 EalgkSQVFYTNCSCVA-------GNGTVPAGSCESACSRLVLPFIVLF 557
Cdd:cd17403 357 D----GQKVYSNCSCIQsnssktsTAATGKACPCETCCQKLYLFLAVFF 401
MFS_SLCO5_OATP5 cd17404
Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of ...
41-577 1.66e-93

Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 5 (SLCO5) or Organic anion transporting polypeptide 5 (OATP5) family contains only one subfamily, OATP5A, which contains only one mammalian member OATP5A1 (encoded by SLCO5A1). Deletion of the SLCO5A1 gene has been implicated in the pathogenesis of Mesomelia-synostoses syndrome (MSS), a rare autosomal-dominant disorder characterized by mesomelic limb shortening, acral synostoses, and multiple congenital malformations. OATP5A1 may be a non-classical OATP which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration. It seems to affect intracellular transport of drugs and may participate in chemoresistance of small cell lung cancer (SCLC by sequestration), rather than mediating cellular uptake. The SLCO5/OATP5 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340962 [Multi-domain]  Cd Length: 425  Bit Score: 296.19  E-value: 1.66e-93
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  41 KFFVLCHSLLQLTQ-LMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17404   1 KAFLVCMCLLIFIQsALSSGYLNSVITTIEKRYSLKSSESGLIVSSYEIGSLLTVVFVSYFGGRGHRPRWIAVGGVLIAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFIsepyrydhsssdnrsldfeasLClpttmapasalsngscsshtetkhltmvgimfaAQTLLGIGGVPIQ 199
Cdd:cd17404  81 GSFLFSLPHFF---------------------IL---------------------------------AQILIGMGGTPIF 106
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPeggINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17404 107 TLGTTYLDDHVKKESSSLYLAIMYVMGALGPAAGFLLGGLLINFYVDPLSTP---PDISPGDPRWIGAWWGGFLLCGIAL 183
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPRempkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvqfvkvfprvllrnlrh 359
Cdd:cd17404 184 LLVAFPFFTFPK-------------------------------------------------------------------- 195
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17404 196 MTFLVVSLGYCMELAIVSGFITFLPKYLETQFGIPASNANIFTGVIAVPGAGIGIVLGGYILKRFKLGPKGAAKLALICN 275
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQD------LGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRV 513
Cdd:cd17404 276 FLSLLLFLTLFFLGCESIKLAGITIPyttgpsLSSTHGRNLTSECNVNCGCSINEYEPVCGSDG-ITYFSPCLAGCTSVG 354
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 29789421 514 VQEALGKSqvfYTNCSCVAGN--GTVPAGSCESACS--------RLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17404 355 NTSTGIRN---YTNCACLQSRssISPPTVGQGSQLQagpcsrtcNTLIPFLILLFIVTLITACAQMPALMITLR 425
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
40-577 1.14e-89

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 286.82  E-value: 1.14e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17402   1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRydhsssdnrsldfeaslclpttmapasalsngscsshTETKHLTMVGimfaAQTLLGIGGVPIQ 199
Cdd:cd17402  81 GALLSALPEFLTHQYK-------------------------------------TNMMYLLLIG----AQVLLGIGATPVQ 119
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17402 120 PLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALL 199
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPREMpkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvQFVKVFPRVLLRNLRH 359
Cdd:cd17402 200 FFSALLMFGFPQSL--------------------------------------------------QQLRVIPKVTKHLLSN 229
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17402 230 PVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVN 309
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLG--AQPGPSLFP--GCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVq 515
Cdd:cd17402 310 LVSTACYVSFLFLGCDTGPVAGVTVPYGndTAPGSSLDPyaPCNSNCECQTDSFSPVCGADG-ITYLSACFAGCSSTNL- 387
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 29789421 516 ealgksqvfyTNCSCVAG----NGTVPAGSCES-ACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17402 388 ----------SGCACLSSvpaeNATVVPGKCPSpGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
MFS_SLCO1_OATP1 cd17400
Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of ...
40-577 2.83e-83

Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1 (SLCO1) or Organic anion transporting polypeptide 1 (OATP1) family contains three subfamilies: OATP1A, OATP1B, and OATP1C. OATP1A contains one human member, OATP1A2, which shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). OATP1B contains two human proteins, OATP1B1 and OATP1B3, which can both accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). OATP1C contains one mammalian member, OATP1C1, which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine). The SLCO1/OATP1 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340958 [Multi-domain]  Cd Length: 436  Bit Score: 269.78  E-value: 2.83e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17400   1 LKMFLLALSCAFVAKTLSGSYMKSMITQIERRFNIPSSLVGFIDGSFEIGNLLVIIFVSYFGTKLHRPKMIGIGCVIMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYDHsssdnrsldfeaslclpttmapasalsngscsshtetkhltMVGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17400  81 GCFLKALPHFFMNQYEYSL-----------------------------------------MWIYVFVGNILRGIGETPIL 119
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17400 120 PLGISYIDDFAKEENSPLYIGLVETGAIIGPIIGFLLGSLCAKVYVDIGFVNLDDIIITPTDTRWVGAWWLGFLICGGVS 199
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPrempkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvqfvkvfprvllrnlrh 359
Cdd:cd17400 200 VLTAIPFFFLP--------------------------------------------------------------------- 210
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17400 211 PIYMLFILVSVIQFNSFVGMITYMPKYLEQQYGQSSSDANFLMGIINIPPIAIGYFIGGLIMKKFKITVKGAAKIGCWLS 290
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPS-----LFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVv 514
Cdd:cd17400 291 VLEYLLYLLSFLMTCENSSVAGLTTSYEGIPPVLyhendIFSDCNSDCNCPEKIWEPVCGNNG-ITYLSACLAGCETSI- 368
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29789421 515 qeALGKSQVFYtNCSCV--AGNGTVPAGSC------ESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17400 369 --GTGKNIVFY-NCSCIqtSGNSSANLSLCdggcprDPDCSLMFQYFLIISVMSSFIYSLGGIPGYMLLLR 436
MFS_SLCO1B_OATP1B cd17457
Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of ...
40-577 4.93e-83

Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1B (SLCO1B), also called organic anion-transporting polypeptide 1B (OATP1B), subfamily is composed of two human proteins, OATP1B1 (encoded by SLCO1B1) and OATP1B3 (encoded by SLCO1B3), and one rodent member, OATP1B2 (encoded by Slco1b2). OATP1B1 and OATP1B3 are almost exclusively expressed on the basal side of hepatocytes in normal human organs. They both can accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). Loss-of-function mutations in both SLCO1B1 and SLCO1B3 genes result in the Rotor syndrome, a hereditary hyperbilirubinemia. The SLCO1B/OATP1B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341015 [Multi-domain]  Cd Length: 455  Bit Score: 269.79  E-value: 4.93e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17457   1 LKMFLAALSFSYFAKALSGIIMKSSITQIERRFDISSSTVGFIDGSFEIGNLLVIAFVSYFGAKLHRPKLIAAGCFIMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFISEPYRYDhsssdnrsldfeaslCLPTTmapasalsngscSSHtetkhltMVGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17457  81 GSVLTALPHFFMGYYKYG---------------CLKES------------GSY-------MWVYVLMGNMLRGIGETPIV 126
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17457 127 PLGISYLDDFAKEENSPLYLACLHTIAMIGPMIGFTLGSLFAKLYVDIGFVDLSTIRITPQDSRWVGAWWLGFLVSGLFS 206
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPrempkekhefhfrrkvlasaastaskgedlssqheplkkqaglaqiapdltlvQFVKVFpRVLLRNLRH 359
Cdd:cd17457 207 IISAIPFFFLP-----------------------------------------------------GFFQSL-KSILTNRLY 232
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQvcTSSMVaGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17457 233 VMFVCLTLLQ--VSSFI-GFFTYKPKYMEQQYGQSSSKANFLLGVITLPIFASGMFLGGYIMKKYKLNTVGAAKFACFTS 309
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPS-----LFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTgrvV 514
Cdd:cd17457 310 VMALSFYLLYFFIGCENKSVAGITMTYDGNNPVTshrdvILSYCNSDCNCDESQWDPVCGNNG-ITYISACLAGCK---S 385
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 29789421 515 QEALGKSQVFYtNCSCV------AGNGTVPAGSC--ESACSRLVLPFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17457 386 SSGNGKPIVFH-NCSCLevtgsqNRNYSAHLGECprDDDCSRMFYFYVVIQVLNLFFSALGGTSAYMLIVK 455
MFS_SLCO4A_OATP4A cd17462
Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of ...
33-577 2.30e-71

Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4A (SLCO4A), also called Organic anion-transporting polypeptide 4A (OATP4A), subfamily has one mammalian member, OATP4A1 (encoded by SLCO4A1). It is ubiquitously expressed and it mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4A1 is the most abundantly expressed transporter colorectal cancer (CRC) and its role in the transport of estrone sulfate, which is used in hormone replacement therapy (HRT), affects the outcome of the treatment. The SLCO4A/OATP4A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341020 [Multi-domain]  Cd Length: 427  Bit Score: 237.81  E-value: 2.30e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  33 PRGMFhnikFFVLCHSLLQltQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGY 112
Cdd:cd17462   1 PKGVL----FFLCAASFLQ--GMTVNGFINTVITSIERRFDLRSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGW 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 113 GALLVATAGLLMALPHFIsepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhLTMVGimfaaQTLLG 192
Cdd:cd17462  75 GVLIMGLGSLVFALPHFT-----------------------------------------------VFMLG-----QFLHG 102
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 193 IGGVPIQPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDRMpeggINLTPKDPRWVGAWWLGF 272
Cdd:cd17462 103 IGATPLYTLGVTYLDENVKSNYSPVYIGIFYTAAIVGPAAGYLLGGFFLNIYTEIGRQ----TELTPENPLWVGAWWIGF 178
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 273 LISSGLVVLASSPYFFFPREMPkekhefhfrrkvlasaastaskgedlssqheplkkqaGLaqiapdltlvqfvkvfprv 352
Cdd:cd17462 179 LGAGAAALLIALPILGYPRQLP-------------------------------------GL------------------- 202
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 353 llrnLRHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLspvQCS 432
Cdd:cd17462 203 ----LKNPTFIFLCLAGATEATLIAGMSTFGPKFLESQFSLSASEAATLFGYLVVPAGGGGTFLGGFIVNKLKL---RCS 275
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 433 ALCL--LGSLLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPS----LFPGCSEPCSCQSDDFNPVCdTSAYVEYTTPCH 506
Cdd:cd17462 276 GIIKfcLICTVVSLLAIFIFSLHCPNVPMAGVTASYRGSVLPEgslnLTALCNADCRCLEEIYSPVC-GADGLMYYSPCH 354
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 29789421 507 AGCTGrvVQEALGKSQVFYTNCSCVAGN-----GTVPAGSCESACSR--LVLPFIVLFSLGAGLASIthtPSFMLILR 577
Cdd:cd17462 355 AGCSE--AYSDIRNGQKVYQDCSCVAGNlsvgfGEASAGKCTSNCNHmpLLLAFVFLVILFTFLCSI---PALTATLR 427
MFS_SLCO4C_OATP4C cd17463
Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of ...
41-577 1.92e-68

Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4C (SLCO4C), also called Organic anion-transporting polypeptide 4C (OATP4C), subfamily has one mammalian member, OATP4C1 (encoded by SLCO4C1). It is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. It is the only OATP expressed at the basolateral side of proximal tubular cells in human kidney and it mediates the excretion of uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs) and cause further progression of renal damage and cardiovascular diseases. Overexpression of human SLCO4C1 in rat kidney promotes the renal excretion of uremic toxins and reduces hypertension, cardiomegaly, and renal inflammation in renal failure. The SLCO4C/OATP4C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341021 [Multi-domain]  Cd Length: 429  Bit Score: 230.40  E-value: 1.92e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  41 KFFVLCHSLLQLTQ-LMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17463   2 KGYLLFYSLLAVVQgIVVNGLVNISISTIEKRYELSSSLTGLISSSYDISFCLLSLFVSFYGERGHKPRWLAFSAFMIGL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFIsepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvgIMFAAQTLLGIGGVPIQ 199
Cdd:cd17463  82 GSLVFSLPHFF----------------------------------------------------VFILGQLLLGVGGTPLY 109
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDIDrMPEGgINLTPKDPRWVGAWWLGFLISSGLV 279
Cdd:cd17463 110 TLGTAYIDDSVPTHKSSLYIGIGYGMSVLGPAIGYLLGGQLLNIYIDVN-KGQS-VDLTEEDPRWLGAWWIGFLMCWLIA 187
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 280 VLASSPYFFFPREMPkekhefhfrrkvlasaastaskgedlssqheplkkqaGLaqiapdltlvqfvkvfprvllrnLRH 359
Cdd:cd17463 188 WCLIAPFSCFPKHLP-------------------------------------GL-----------------------LKN 207
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 360 PIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLLGS 439
Cdd:cd17463 208 PVFMCLTISSCSEALITTGFATFLPKFIENQFGQTSSFAAILGGLVLIPGAAIGQILGGIIVSKFKLKCKNMIKFAIITT 287
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 440 LLCLLFSVPLFFIGCSTHQIAGITQDL-GAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQeal 518
Cdd:cd17463 288 TVSLLLLSVFIFAKCGNDPFAGVSETYnGTGKIGNLTAPCNANCSCLSSFYYPVCGADG-VQYFSPCFAGCTNENLH--- 363
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 29789421 519 GKSQVFYtNCSCVA-GNGTV--------PAGSCESACSRLVLpFIVLFSLGAGLASITHTPSFMLILR 577
Cdd:cd17463 364 DKKKVYY-NCSCIGnFTEEFsanttkceEGKKCETTCKNLPI-FLCFFFFVVIFTFMTSTPITVAILR 429
MFS_SLCO6_OATP6 cd17405
Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of ...
40-577 1.88e-30

Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 6 (SLCO6) or Organic anion transporting polypeptide 6 (OATP6) family contains only one subfamily, OATP6A, which contains only one human member OATP6A1 (encoded by SLCO6A1). The OATP6 family is the most diverged of the OATPs. OATP6A1 is also called cancer/testis antigen 48 (CT48) or gonad-specific transporter. It is strongly expressed only in normal testis, and weakly in spleen, brain, fetal brain, and placenta. It is found in tumor samples (lung, bladder, and esophageal) and cancer cell lines (lung), and may be of potential use as a target for therapy for a variety of tumor types. The SLCO6/OATP6 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340963 [Multi-domain]  Cd Length: 428  Bit Score: 124.57  E-value: 1.88e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  40 IKFFVLCHSLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVAT 119
Cdd:cd17405   1 IDGFMILYCILVLIQGAVFGLVDMSIGIFQVQFSLTRTEKYLLDFSYDISSFLVAIIIAHYGSRGNRTRWIAASCFLMGL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 120 AGLLMALPHFisepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvGIMFAAQTLLGIGGVPIQ 199
Cdd:cd17405  81 GSMLFAFPFF----------------------------------------------------TFHIAGQCIQGIAGMPIY 108
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 200 PFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVDidrmpEGGINLTPKD--PRWVGAWWLGFLISSG 277
Cdd:cd17405 109 ILGITFIFDNIPTSSAGIYLGIAHSAYLIGYLLGYVGGLPNFQPPPN-----EKSVEIEVNKvyQLWQSGWWKTFLIAAA 183
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 278 LVVLASSPYFFFPREMPkekhefhfrrkvlasaastaskgedlssqheplkkqaGLaqiapdltlvqfvkvfprvllrnL 357
Cdd:cd17405 184 IAWCTSFPLVCFPTSLP-------------------------------------GL-----------------------L 203
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 358 RHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQCSALCLL 437
Cdd:cd17405 204 KNPLLLCQAICKATEYLTFIGALEFLPHYLENQFLLTPGIASLLTGAFLIPGGAIGHFLGGLIVSRLEMSCKNKMRFILV 283
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 438 GSLLCLLFSVPLFFIGCSTHQIAGITQDL-GAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQE 516
Cdd:cd17405 284 TSVISLGLFVLIFFVECQTVTFAGINEDYdGYGQLGNLTAPCNEYCDCTSSLYTSICGRDE-IEYFSPCFAGCKASKVSN 362
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 29789421 517 algkSQVFYTNCSCV--------AGNGTVPA--GSCESACSRLVLPFIVLFS--LGAGLASIthtPSFMLILR 577
Cdd:cd17405 363 ----TEKTYYNCSCIkeglaaadDEGDFIDAiaGKCDSKCYKLPLFFAFYFSatVFSNMCSI---PIILIILR 428
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
474-531 5.66e-16

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650 [Multi-domain]  Cd Length: 54  Bit Score: 72.34  E-value: 5.66e-16
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 29789421 474 LFPGCSEPCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQealGKSQVfYTNCSCV 531
Cdd:cd01330   1 LTSSCNSNCSCSESAYSPVCGENG-ITYFSPCHAGCTNSTGS---GGSKI-YTNCSCV 53
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
48-430 1.81e-07

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 53.58  E-value: 1.81e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  48 SLLQLTQLMISGYLKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVATAGLLMALP 127
Cdd:cd06174   2 LLGFFLTGLARGLISPLLPALLQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAFA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 128 HfisepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltMVGIMFAAQTLLGIGGVPIQPFGISYID 207
Cdd:cd06174  82 P---------------------------------------------------SFWLLLLGRFLLGLGSGLIDPAVLALIA 110
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 208 DFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYVdidrmpegginltpkdprwvGAWWLGFLISSGLVVLASSPYF 287
Cdd:cd06174 111 DLFPERERGRALGLLQAFGSVGGILGPLLGGILASSLG--------------------FGWRAVFLIAAALALLAAILLL 170
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 288 FFPREMPKEkhefhfrRKVLASAASTASKGEDLssqheplkkqaglaqiapdltlvqfvkvfpRVLLRNlrhPIFLLVVL 367
Cdd:cd06174 171 LVVPDPPES-------ARAKNEEASSKSVLKLL------------------------------KRVLKN---PGLWLLLL 210
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 29789421 368 SQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVLVKRLHLSPVQ 430
Cdd:cd06174 211 AIFLVNLAYYSFSTLLPLFLLDLGGLSVAVAGLLLSLFGLAGALGSLLLGLLSDRLIGRKPLL 273
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
481-530 1.86e-04

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 400135  Cd Length: 50  Bit Score: 39.40  E-value: 1.86e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 29789421   481 PCSCQSDDFNPVCDTSAyVEYTTPCHAGCTGRVVQEALGKSQVFYtNCSC 530
Cdd:pfam07648   3 NCQCPKTEYEPVCGSDG-VTYPSPCALCAAGCKLGKEVKEEKVKY-DGSC 50
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
486-530 3.83e-03

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 35.32  E-value: 3.83e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*
gi 29789421 486 SDDFNPVCDTSAyVEYTTPCHAGCTGRVVQEALGKsqvfYTNCSC 530
Cdd:cd00104   2 PKEYDPVCGSDG-KTYSNECHLGCAACRSGRSITV----AHNGPC 41
MFS_spinster_like cd17328
Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters; ...
57-424 5.04e-03

Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters; The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340886 [Multi-domain]  Cd Length: 405  Bit Score: 39.91  E-value: 5.04e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  57 ISGYLKSsistVEKRFGLSSQISGLL-AAFNEVGNVSLILFvSYFGSRVHRPRMIGYGALLVATAGLLMAL-PHFISepy 134
Cdd:cd17328  18 IAGVLPD----IQSDFLIDDSLAGLLqTVFIISYMVLSPIF-GYLGDRYNRKWILAVGILIWSAATLLSSFaPNFWQ--- 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 135 rydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltmvgiMFAAQTLLGIG---GVPIQPfgiSYIDDFAH 211
Cdd:cd17328  90 -------------------------------------------------LLLFRALVGIGeasYSPIAP---TIIADLFP 117
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 212 HSNSPLYIGILFGITTMGPGLAYGLGSLMlrlyvdidrmpegginltpkdPRWVGAWWLGFLISSGLVVLASSPYFFFPR 291
Cdd:cd17328 118 KEKRTRALGVFYFAIPLGSGLGYVVGGLV---------------------AQATGGWRWAFRVTGVLGVLLAILLLLFVR 176
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 292 EMPKEKHEFHFRRKVLASaastaSKGEDLssqheplkkqaglaqiapdltlvqfvkvfpRVLLRNlrhPIFLLVVLSQVC 371
Cdd:cd17328 177 EPPRGAAEGGVMAKSTAT-----SFLADL------------------------------KALAKN---PSFILSTLGFTA 218
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 29789421 372 TSSMVAGMATFLPKFLERQFSI---TASFANMLLGCLTIPLVIVGIMMGGVLVKRL 424
Cdd:cd17328 219 VSFVTGALAFWAPTFFLRAFGVgdlSSADVGLIFGAITCIAGVLGVLLGGILADRL 274
MFS_1 pfam07690
Major Facilitator Superfamily;
43-424 5.30e-03

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 39.71  E-value: 5.30e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421    43 FVLCHSLLQLTQLMISGYLKSSISTVekrFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVATAGL 122
Cdd:pfam07690   1 LFLAAFLAALGRSLLGPALPLLLAED---LGISPTEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   123 LMALPHfisepyrydhsssdnrsldfeaslclpttmapasalsngscsshtetkhltMVGIMFAAQTLLGIGGVPIQPFG 202
Cdd:pfam07690  78 LLLFAS---------------------------------------------------SLWLLLVLRVLQGLGAGALFPAA 106
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   203 ISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLMLRLYvdidrmpegginltpkDPRWVgawwlgFLISSGLVVLA 282
Cdd:pfam07690 107 AALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLF----------------GWRAA------FLILAILSLLA 164
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421   283 SSPYFFFPREMPKEKHEFHFRRKVLASAAStaskgedlssqheplkkqaglaqiapdltlvqfvkvfprvLLRNLRHPIF 362
Cdd:pfam07690 165 AVLAALLLPRPPPESKRPKPAEEAPAPLLP----------------------------------------AWKLLLRDPV 204
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 29789421   363 LLVVLSQVCTSSMVAGMATFLPKFLERQ-FSITASFANMLLGCLtipLVIVGIMMGGVLVKRL 424
Cdd:pfam07690 205 LWLLLALLLFGFAFFGLLTYLPLYQEVLgLSALLAGLLLGLAGL---LGAIGRLLLGRLSDRL 264
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
70-418 9.37e-03

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 38.71  E-value: 9.37e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421  70 KRFGLSSQISGLLAAfneVGNVSLILFVSYFGS---RVHRPRMIGYGALLVATAGLLMALphfisepyrydhsssdnrsl 146
Cdd:cd17325  24 ESLGASVAQIGLIVA---AYALAQLLFSPPAGRlsdRFGRKRLLLLGLLLLAVSTLLFAF-------------------- 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 147 dfeaslclpttmapasalsngscsSHTetkhltmVGIMFAAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYIGILFGIT 226
Cdd:cd17325  81 ------------------------ATS-------YWQLLLARFLQGLASAAVWPAAMALIADIAPPEERGRAMGIFSSAI 129
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 227 TMGPGLAYGLGSLMLrlyvdidrmpegginltpkdprWVGAWWLGFLISSGLVVLASSPYFFFPREMPKEKHEfhfrrkv 306
Cdd:cd17325 130 GLGFLIGPLLGGLLA----------------------DALGYRAPFLVCAALALLALVLALLLLPEPRPPPNK------- 180
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29789421 307 lasaastaskgedlssqheplkkqaglaqiapdlTLVQFVKVFPRVLLRNLRHPIFLLVVLSqVCTSSMVAGMATFLPKF 386
Cdd:cd17325 181 ----------------------------------RAVSAARLRSGLRLLLRDRRLLALFLAI-FVLAFAFGALEPFLPLY 225
                       330       340       350
                ....*....|....*....|....*....|..
gi 29789421 387 LERQFSITASFANMLLGCLTIPLVIVGIMMGG 418
Cdd:cd17325 226 AAELGGLSPAQIGLLFGAQGLASALSQPPAGK 257
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH