NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|62526126|ref|NP_780562|]
View 

exocyst complex component 6 [Mus musculus]

Protein Classification

SEC15 family protein (domain architecture ID 10513678)

SEC15 family protein similar to human exocyst complex component 6A/B, which are components of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Sec15 pfam04091
Exocyst complex subunit Sec15-like;
456-762 5.75e-132

Exocyst complex subunit Sec15-like;


:

Pssm-ID: 397972  Cd Length: 308  Bit Score: 394.97  E-value: 5.75e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   456 YKVVISRFPFQDPDLE----KQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSS 531
Cdd:pfam04091   1 YDKVLKVCWLKPSELEeapsEPTFPVTLPFSQMYPLCCIDIRNFINKFYKFSEDFYQHHREIDDILRKSLDLLLIRVVSE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   532 CLLNLIRKPHiGLTELVQIIINTTHLEQACKYLEDFITNItNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDE 611
Cdd:pfam04091  81 SLLSRLNSTS-NLSQIAQILINLEYFETACKELEKLLAQL-RISQNRGGTIRLTATKVFKDTRKAAEKRIFELVNSKIDD 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   612 FVQLADYDWTMAESDGRASGYLMDLINFLRSIFQ-VFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQF 690
Cdd:pfam04091 159 FLELAEYDWTPTEVETEPSGYLQDLIAFLETIFSsTLTNLPESVKTLVYFRALDHIAESLLDLLLSPDVKRINENAVSNF 238
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62526126   691 NLDVIQCELFASSEPVPGFqGDTLQLAFIDLRQLLDLFMVWDWSTYLaDYGQPASKYLRVNPHAALTLLEKM 762
Cdd:pfam04091 239 DLDVKYLESFAASLPVPGL-EESLESTFIELRQLLDLLLSDNVEEYL-DPGIRMRKYSRVKPKKAIILLEKL 308
 
Name Accession Description Interval E-value
Sec15 pfam04091
Exocyst complex subunit Sec15-like;
456-762 5.75e-132

Exocyst complex subunit Sec15-like;


Pssm-ID: 397972  Cd Length: 308  Bit Score: 394.97  E-value: 5.75e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   456 YKVVISRFPFQDPDLE----KQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSS 531
Cdd:pfam04091   1 YDKVLKVCWLKPSELEeapsEPTFPVTLPFSQMYPLCCIDIRNFINKFYKFSEDFYQHHREIDDILRKSLDLLLIRVVSE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   532 CLLNLIRKPHiGLTELVQIIINTTHLEQACKYLEDFITNItNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDE 611
Cdd:pfam04091  81 SLLSRLNSTS-NLSQIAQILINLEYFETACKELEKLLAQL-RISQNRGGTIRLTATKVFKDTRKAAEKRIFELVNSKIDD 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   612 FVQLADYDWTMAESDGRASGYLMDLINFLRSIFQ-VFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQF 690
Cdd:pfam04091 159 FLELAEYDWTPTEVETEPSGYLQDLIAFLETIFSsTLTNLPESVKTLVYFRALDHIAESLLDLLLSPDVKRINENAVSNF 238
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62526126   691 NLDVIQCELFASSEPVPGFqGDTLQLAFIDLRQLLDLFMVWDWSTYLaDYGQPASKYLRVNPHAALTLLEKM 762
Cdd:pfam04091 239 DLDVKYLESFAASLPVPGL-EESLESTFIELRQLLDLLLSDNVEEYL-DPGIRMRKYSRVKPKKAIILLEKL 308
 
Name Accession Description Interval E-value
Sec15 pfam04091
Exocyst complex subunit Sec15-like;
456-762 5.75e-132

Exocyst complex subunit Sec15-like;


Pssm-ID: 397972  Cd Length: 308  Bit Score: 394.97  E-value: 5.75e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   456 YKVVISRFPFQDPDLE----KQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSS 531
Cdd:pfam04091   1 YDKVLKVCWLKPSELEeapsEPTFPVTLPFSQMYPLCCIDIRNFINKFYKFSEDFYQHHREIDDILRKSLDLLLIRVVSE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   532 CLLNLIRKPHiGLTELVQIIINTTHLEQACKYLEDFITNItNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDE 611
Cdd:pfam04091  81 SLLSRLNSTS-NLSQIAQILINLEYFETACKELEKLLAQL-RISQNRGGTIRLTATKVFKDTRKAAEKRIFELVNSKIDD 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62526126   612 FVQLADYDWTMAESDGRASGYLMDLINFLRSIFQ-VFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQF 690
Cdd:pfam04091 159 FLELAEYDWTPTEVETEPSGYLQDLIAFLETIFSsTLTNLPESVKTLVYFRALDHIAESLLDLLLSPDVKRINENAVSNF 238
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62526126   691 NLDVIQCELFASSEPVPGFqGDTLQLAFIDLRQLLDLFMVWDWSTYLaDYGQPASKYLRVNPHAALTLLEKM 762
Cdd:pfam04091 239 DLDVKYLESFAASLPVPGL-EESLESTFIELRQLLDLLLSDNVEEYL-DPGIRMRKYSRVKPKKAIILLEKL 308
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH