NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|30061375|ref|NP_835492|]
View 

histone H2A type 1-P [Mus musculus]

Protein Classification

histone H2A (domain architecture ID 11487859)

histone H2A is a core component of the nucleosome which plays a central role in DNA double strand break (DSB) repair

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTZ00017 PTZ00017
histone H2A; Provisional
1-130 5.74e-70

histone H2A; Provisional


:

Pssm-ID: 185399  Cd Length: 134  Bit Score: 206.13  E-value: 5.74e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKQGGKARAKAK--TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTR 78
Cdd:PTZ00017   1 KGGKGKTGGGKAGKKKpvSRSAKAGLQFPVGRVHRYLKKGRYAKRVGAGAPVYLAAVLEYLTAEVLELAGNAAKDNKKKR 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 30061375   79 IIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 130
Cdd:PTZ00017  81 ITPRHIQLAIRNDEELNKLLAGVTIASGGVLPNIHKVLLPKKSKPKQGKKQN 132
 
Name Accession Description Interval E-value
PTZ00017 PTZ00017
histone H2A; Provisional
1-130 5.74e-70

histone H2A; Provisional


Pssm-ID: 185399  Cd Length: 134  Bit Score: 206.13  E-value: 5.74e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKQGGKARAKAK--TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTR 78
Cdd:PTZ00017   1 KGGKGKTGGGKAGKKKpvSRSAKAGLQFPVGRVHRYLKKGRYAKRVGAGAPVYLAAVLEYLTAEVLELAGNAAKDNKKKR 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 30061375   79 IIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 130
Cdd:PTZ00017  81 ITPRHIQLAIRNDEELNKLLAGVTIASGGVLPNIHKVLLPKKSKPKQGKKQN 132
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
6-120 1.31e-68

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029  Cd Length: 115  Bit Score: 201.79  E-value: 1.31e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375   6 KQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQ 85
Cdd:cd00074   1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYAERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHLQ 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 30061375  86 LAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK 120
Cdd:cd00074  81 LAVRNDEELNKLLKGVTIASGGVLPNIHKVLLPKK 115
H2A smart00414
Histone 2A;
17-122 7.33e-67

Histone 2A;


Pssm-ID: 197711  Cd Length: 106  Bit Score: 197.17  E-value: 7.33e-67
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375     17 TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK 96
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAKRVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELNK 80
                           90       100
                   ....*....|....*....|....*.
gi 30061375     97 LLGRVTIAQGGVLPNIQAVLLPKKTE 122
Cdd:smart00414  81 LLKGVTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
3-127 2.01e-53

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587  Cd Length: 132  Bit Score: 164.26  E-value: 2.01e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375   3 GRGKQGGKARAKA-KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP 81
Cdd:COG5262   3 SGGKGGKAADARVsQSRSAKAGLIFPVGRVKRLLKKGNYRMRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKKRIIP 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 30061375  82 RHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKA 127
Cdd:COG5262  83 RHLQLAIRNDEELNKLLGDVTIAQGGVLPNINPGLLPKSSKKGSKR 128
Histone_H2A_C pfam16211
C-terminus of histone H2A;
92-126 1.39e-17

C-terminus of histone H2A;


Pssm-ID: 406592  Cd Length: 35  Bit Score: 70.25  E-value: 1.39e-17
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 30061375    92 EELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHK 126
Cdd:pfam16211   1 EELNKLLGGVTIAQGGVLPNIHKVLLPKKTKKKKK 35
 
Name Accession Description Interval E-value
PTZ00017 PTZ00017
histone H2A; Provisional
1-130 5.74e-70

histone H2A; Provisional


Pssm-ID: 185399  Cd Length: 134  Bit Score: 206.13  E-value: 5.74e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKQGGKARAKAK--TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTR 78
Cdd:PTZ00017   1 KGGKGKTGGGKAGKKKpvSRSAKAGLQFPVGRVHRYLKKGRYAKRVGAGAPVYLAAVLEYLTAEVLELAGNAAKDNKKKR 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 30061375   79 IIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 130
Cdd:PTZ00017  81 ITPRHIQLAIRNDEELNKLLAGVTIASGGVLPNIHKVLLPKKSKPKQGKKQN 132
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
6-120 1.31e-68

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029  Cd Length: 115  Bit Score: 201.79  E-value: 1.31e-68
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375   6 KQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQ 85
Cdd:cd00074   1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYAERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHLQ 80
                        90       100       110
                ....*....|....*....|....*....|....*
gi 30061375  86 LAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK 120
Cdd:cd00074  81 LAVRNDEELNKLLKGVTIASGGVLPNIHKVLLPKK 115
H2A smart00414
Histone 2A;
17-122 7.33e-67

Histone 2A;


Pssm-ID: 197711  Cd Length: 106  Bit Score: 197.17  E-value: 7.33e-67
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375     17 TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK 96
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAKRVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELNK 80
                           90       100
                   ....*....|....*....|....*.
gi 30061375     97 LLGRVTIAQGGVLPNIQAVLLPKKTE 122
Cdd:smart00414  81 LLKGVTIAQGGVLPNIHKVLLPKKTG 106
PLN00157 PLN00157
histone H2A; Provisional
1-130 1.31e-65

histone H2A; Provisional


Pssm-ID: 177758  Cd Length: 132  Bit Score: 195.07  E-value: 1.31e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKQ-GGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI 79
Cdd:PLN00157   1 MSGRGKRkGGGGGKKATSRSAKAGLQFPVGRIARYLKAGKYATRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 30061375   80 IPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 130
Cdd:PLN00157  81 VPRHIQLAVRNDEELSKLLGGVTIAAGGVLPNIHSVLLPKKSGKSKGEPKD 131
PLN00156 PLN00156
histone H2AX; Provisional
1-121 1.17e-57

histone H2AX; Provisional


Pssm-ID: 215080  Cd Length: 139  Bit Score: 175.16  E-value: 1.17e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII 80
Cdd:PLN00156   5 GTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKNRIV 84
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 30061375   81 PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKT 121
Cdd:PLN00156  85 PRHIQLAVRNDEELSKLLGSVTIAAGGVLPNIHQTLLPKKV 125
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
3-127 2.01e-53

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587  Cd Length: 132  Bit Score: 164.26  E-value: 2.01e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375   3 GRGKQGGKARAKA-KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP 81
Cdd:COG5262   3 SGGKGGKAADARVsQSRSAKAGLIFPVGRVKRLLKKGNYRMRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKKRIIP 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 30061375  82 RHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKA 127
Cdd:COG5262  83 RHLQLAIRNDEELNKLLGDVTIAQGGVLPNINPGLLPKSSKKGSKR 128
PLN00153 PLN00153
histone H2A; Provisional
1-122 2.58e-53

histone H2A; Provisional


Pssm-ID: 165721  Cd Length: 129  Bit Score: 163.74  E-value: 2.58e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKqGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII 80
Cdd:PLN00153   1 MAGRGK-GKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIV 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 30061375   81 PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122
Cdd:PLN00153  80 PRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTK 121
PLN00154 PLN00154
histone H2A; Provisional
1-122 4.18e-39

histone H2A; Provisional


Pssm-ID: 177756  Cd Length: 136  Bit Score: 128.14  E-value: 4.18e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375    1 MSGRGKQGGKA-------------RAKAKTRSSRAGLQFPVGRVHRLLRKG-NYSERVGAGAPVYLAAVLEYLTAEILEL 66
Cdd:PLN00154   1 MSGKGGKGLLAakttaaaakkdkdKKKPTSRSSRAGLQFPVGRIHRQLKQRvSAHGRVGATAAVYTAAILEYLTAEVLEL 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 30061375   67 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLgRVTIAQGGVLPNIQAVLLPKKTE 122
Cdd:PLN00154  81 AGNASKDLKVKRITPRHLQLAIRGDEELDTLI-KGTIAGGGVIPHIHKSLINKSTK 135
PTZ00252 PTZ00252
histone H2A; Provisional
10-128 4.38e-32

histone H2A; Provisional


Pssm-ID: 240330  Cd Length: 134  Bit Score: 110.05  E-value: 4.38e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375   10 KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDN--KKTRIIPRHLQLA 87
Cdd:PTZ00252  10 KASKSGSGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAAAQQakKPKRLTPRTVTLA 89
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 30061375   88 IRNDEELNKLLGRVTIAQGGVLPNIQAVlLPKKTESHHKAK 128
Cdd:PTZ00252  90 VRHDDDLGSLLKNVTLSRGGVMPSLNKA-LAKKHKSGKKAK 129
PLN00155 PLN00155
histone H2A; Provisional
1-59 6.34e-19

histone H2A; Provisional


Pssm-ID: 165723  Cd Length: 58  Bit Score: 74.36  E-value: 6.34e-19
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 30061375    1 MSGRGKqGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYL 59
Cdd:PLN00155   1 MAGRGK-GKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYL 58
Histone_H2A_C pfam16211
C-terminus of histone H2A;
92-126 1.39e-17

C-terminus of histone H2A;


Pssm-ID: 406592  Cd Length: 35  Bit Score: 70.25  E-value: 1.39e-17
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 30061375    92 EELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHK 126
Cdd:pfam16211   1 EELNKLLGGVTIAQGGVLPNIHKVLLPKKTKKKKK 35
Histone pfam00125
Core histone H2A/H2B/H3/H4;
4-89 2.74e-15

Core histone H2A/H2B/H3/H4;


Pssm-ID: 333859  Cd Length: 127  Bit Score: 67.05  E-value: 2.74e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30061375     4 RGKQGGKARAKAKTRSSRAGL---QFPVGRVHRLLRKGNYSE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI 79
Cdd:pfam00125  36 RYRPGTVALKEIRKYQKSTDLliyKLPFARVVREIVKSTKTDlRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTI 115
                          90
                  ....*....|
gi 30061375    80 IPRHLQLAIR 89
Cdd:pfam00125 116 TPKDIQLARR 125
BUR6 COG5247
Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];
25-97 6.66e-07

Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];


Pssm-ID: 227572  Cd Length: 113  Bit Score: 44.95  E-value: 6.66e-07
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 30061375  25 QFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL 97
Cdd:COG5247  23 RFPIARLKKIMQLDEDIGKVGQSTPVIASKALEMFLTEIVGLSLKEARKKSSKRMTSEFLKRATESDEKFDFL 95
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH