NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|110625837|ref|NP_898988|]
View 

pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Pyr_redox_2 super family cl39093
Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II ...
43-381 1.56e-19

Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.


The actual alignment was detected with superfamily member pfam07992:

Pssm-ID: 423044 [Multi-domain]  Cd Length: 301  Bit Score: 88.91  E-value: 1.56e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837   43 VIKAVTNFRQVSKVLEEFDVEEQPGTMLESRFPNIKVIEsGVKQLKSEDhcIFTEDGREFVYKKLCLCAGAKPKLI-YEG 121
Cdd:pfam07992  52 APEIASLWADLYKRKEEVVKKLNNGIEVLLGTEVVSIDP-GAKKVVLEE--LVDGDGETITYDRLVIATGARPRLPpIPG 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  122 --NPRVLGIRDTDSAQEFQKELaKARRIMIVGNGGIALELAYEIE--GCEVVWaIKDNAIGNTFFDAGAAEFLtsklmse 197
Cdd:pfam07992 129 veLNVGFLVRTLDSAEALRLKL-LPKRVVVVGGGYIGVELAAALAklGKEVTL-IEALDRLLRAFDEEISAAL------- 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  198 kseakiahkrtiytvEEAKKEtrtkskadyvgsalgpdwhgglalkgteefsHSVHIETRCEVKKIyleeefkimkkksl 277
Cdd:pfam07992 200 ---------------EKALEK-------------------------------NGVEVRLGTSVKEI-------------- 219
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  278 afpKDHHKSVTadkemwpvyVELTNGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDi 357
Cdd:pfam07992 220 ---IGDGDGVE---------VILKDGTEIDADLVVVAIGRRPN-TELLEAAGLELDERGGIVVDEYLRTSVPGIYAAGD- 285
                         330       340
                  ....*....|....*....|....
gi 110625837  358 ctaCWQPSPvwqqmRLWTQARQMG 381
Cdd:pfam07992 286 ---CRVGGP-----ELAQNAVAQG 301
NirB super family cl34210
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];
298-492 7.84e-13

NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];


The actual alignment was detected with superfamily member COG1251:

Pssm-ID: 224171 [Multi-domain]  Cd Length: 793  Bit Score: 70.81  E-value: 7.84e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 298 VELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGDiCTAcwqpspvWQQM 371
Cdd:COG1251  222 VRFADGTEIPADLVVMAVGIRPND---------ELAKEAGLAvnrgivVNDYMQTSDPDIYAVGE-CAE-------HRGK 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 372 R------LWTQARqmgyyaakcMAAASMghpidMDFSFELFAHVTKFFNYKVV---LLGKYNAQGLGADHELMLRCTRGQ 442
Cdd:COG1251  285 VyglvapLYEQAK---------VLADHL-----CGGEAEAYEGSVTSTKLKVSgvdVFSAGDFQETEGAESIVFRDEQRG 350
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 110625837 443 EYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNID 492
Cdd:COG1251  351 IYKKLVLKDDKIVGAVLYGDTSDGGWLLDLILKGADISEIRDTLILPQGS 400
 
Name Accession Description Interval E-value
Pyr_redox_2 pfam07992
Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II ...
43-381 1.56e-19

Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.


Pssm-ID: 400379 [Multi-domain]  Cd Length: 301  Bit Score: 88.91  E-value: 1.56e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837   43 VIKAVTNFRQVSKVLEEFDVEEQPGTMLESRFPNIKVIEsGVKQLKSEDhcIFTEDGREFVYKKLCLCAGAKPKLI-YEG 121
Cdd:pfam07992  52 APEIASLWADLYKRKEEVVKKLNNGIEVLLGTEVVSIDP-GAKKVVLEE--LVDGDGETITYDRLVIATGARPRLPpIPG 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  122 --NPRVLGIRDTDSAQEFQKELaKARRIMIVGNGGIALELAYEIE--GCEVVWaIKDNAIGNTFFDAGAAEFLtsklmse 197
Cdd:pfam07992 129 veLNVGFLVRTLDSAEALRLKL-LPKRVVVVGGGYIGVELAAALAklGKEVTL-IEALDRLLRAFDEEISAAL------- 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  198 kseakiahkrtiytvEEAKKEtrtkskadyvgsalgpdwhgglalkgteefsHSVHIETRCEVKKIyleeefkimkkksl 277
Cdd:pfam07992 200 ---------------EKALEK-------------------------------NGVEVRLGTSVKEI-------------- 219
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  278 afpKDHHKSVTadkemwpvyVELTNGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDi 357
Cdd:pfam07992 220 ---IGDGDGVE---------VILKDGTEIDADLVVVAIGRRPN-TELLEAAGLELDERGGIVVDEYLRTSVPGIYAAGD- 285
                         330       340
                  ....*....|....*....|....
gi 110625837  358 ctaCWQPSPvwqqmRLWTQARQMG 381
Cdd:pfam07992 286 ---CRVGGP-----ELAQNAVAQG 301
FadH2 COG0446
NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase ...
21-464 6.52e-15

NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase [Lipid transport and metabolism];


Pssm-ID: 223523 [Multi-domain]  Cd Length: 415  Bit Score: 76.49  E-value: 6.52e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  21 TCAEQLAVSFPEEDILLVTASPviKAVTNFRQVSKVLEE--FDVEEQPGTMLESRFPNIKV-IESGVKQLKSEDHCIFTE 97
Cdd:COG0446   12 SAATTLRRLLLAAEITLIGREP--KYSYYRCPLSLYVGGgiASLEDLRYPPRFNRATGIDVrTGTEVTSIDPENKVVLLD 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  98 DGREFvYKKLCLCAGAKPK-LIYEGNPRVLGIRDTDSAQEFQKELAKARRIMIVGNGGIALELAYEI--EGCEVVWAIKD 174
Cdd:COG0446   90 DGEIE-YDYLVLATGARPRpPPISDWEGVVTLRLREDAEALKGGAEPPKDVVVVGAGPIGLEAAEAAakRGKKVTLIEAA 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 175 NAIGNTFFDAGAAEFLTSKLmsekseakiahkrtiytveeakketrtkskadyvgsalgpDWHGglalkgteefshsVHI 254
Cdd:COG0446  169 DRLGGQLLDPEVAEELAELL----------------------------------------EKYG-------------VEL 195
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 255 ETRCEVKKIYLEEefkimkkkslafpkdhhksvtadKEMWPVYVELTNGTIYGCDFLVSATGVTPNVHPFLHRNNFALGE 334
Cdd:COG0446  196 LLGTKVVGVEGKG-----------------------NTLVVERVVGIDGEEIKADLVIIGPGERPNVVLANDALPGLALA 252
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 335 DGGLRVDDQMRTSL-PDIYAAGDICTACWQPSPVWQQMRLWTQARQMGYyaakcMAAASMGHPIDMDFSFELFahVTKFF 413
Cdd:COG0446  253 GGAVLVDERGGTSKdPDVYAAGDVAEIPAAETGKGGRIALWAIAVAAGR-----IAAENIAGALRIPGLLGTV--ISDVG 325
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|.
gi 110625837 414 NYKVVLLGKYNAQGLGADHELMLRCtrGQEYVKVVMQNGRMMGAVLIGETD 464
Cdd:COG0446  326 DLCAASTGLTEGKERGIDVVLVVSG--GKDPRAHLYPGAELVGIKLVGDAD 374
NirB COG1251
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];
298-492 7.84e-13

NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];


Pssm-ID: 224171 [Multi-domain]  Cd Length: 793  Bit Score: 70.81  E-value: 7.84e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 298 VELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGDiCTAcwqpspvWQQM 371
Cdd:COG1251  222 VRFADGTEIPADLVVMAVGIRPND---------ELAKEAGLAvnrgivVNDYMQTSDPDIYAVGE-CAE-------HRGK 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 372 R------LWTQARqmgyyaakcMAAASMghpidMDFSFELFAHVTKFFNYKVV---LLGKYNAQGLGADHELMLRCTRGQ 442
Cdd:COG1251  285 VyglvapLYEQAK---------VLADHL-----CGGEAEAYEGSVTSTKLKVSgvdVFSAGDFQETEGAESIVFRDEQRG 350
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 110625837 443 EYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNID 492
Cdd:COG1251  351 IYKKLVLKDDKIVGAVLYGDTSDGGWLLDLILKGADISEIRDTLILPQGS 400
PRK04965 PRK04965
NADH:flavorubredoxin reductase NorW;
58-356 8.99e-09

NADH:flavorubredoxin reductase NorW;


Pssm-ID: 179902 [Multi-domain]  Cd Length: 377  Bit Score: 57.23  E-value: 8.99e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  58 EEFDVEEQPGTMLESrfpnikvIESGVKQLKSedhcifteDGREFVYKKLCLCAGAK---PKLiyEGNPRVLGIrdtDSA 134
Cdd:PRK04965  69 EQFNLRLFPHTWVTD-------IDAEAQVVKS--------QGNQWQYDKLVLATGASafvPPI--PGRELMLTL---NSQ 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 135 QEF---QKELAKARRIMIVGNGGIALELAYEI--EGCEVVwaIKDNAigntffdagaaEFLTSKLMSEKSEAKIAHKRTi 209
Cdd:PRK04965 129 QEYraaETQLRDAQRVLVVGGGLIGTELAMDLcrAGKAVT--LVDNA-----------ASLLASLMPPEVSSRLQHRLT- 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 210 ytveeakketrtkskadyvgsalgpdwhgglalkgteefSHSVHIETRCEVKKIyleeefkimkkkslafpkdhhkSVTA 289
Cdd:PRK04965 195 ---------------------------------------EMGVHLLLKSQLQGL----------------------EKTD 213
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110625837 290 DKemwpVYVELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGD 356
Cdd:PRK04965 214 SG----IRATLDSGRSIEVDAVIAAAGLRPNT---------ALARRAGLAvnrgivVDSYLQTSAPDIYALGD 273
PRK14989 PRK14989
nitrite reductase subunit NirD; Provisional
302-489 2.64e-06

nitrite reductase subunit NirD; Provisional


Pssm-ID: 184951 [Multi-domain]  Cd Length: 847  Bit Score: 50.12  E-value: 2.64e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 302 NGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTAcwqpspvWQQMRLWTQARqmG 381
Cdd:PRK14989 228 DGSELEVDFIVFSTGIRPQ-DKLATQCGLAVAPRGGIVINDSCQTSDPDIYAIGE-CAS-------WNNRVFGLVAP--G 296
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 382 YYaakcMAAASMGHPIDMDFSFE---LFAHVtKFFNYKVVLLGKYNAQGLGADHELMLrcTRGQEYVK---VVMQNGRMM 455
Cdd:PRK14989 297 YK----MAQVAVDHLLGSENAFEgadLSAKL-KLLGVDVGGIGDAHGRTPGARSYVYL--DESKEIYKrliVSEDNKTLL 369
                        170       180       190
                 ....*....|....*....|....*....|....
gi 110625837 456 GAVLIGETDLEETFENLILNQMDLSSYGEDLLDP 489
Cdd:PRK14989 370 GAVLVGDTSDYGNLLQLVLNAIELPENPDSLILP 403
 
Name Accession Description Interval E-value
Pyr_redox_2 pfam07992
Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II ...
43-381 1.56e-19

Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.


Pssm-ID: 400379 [Multi-domain]  Cd Length: 301  Bit Score: 88.91  E-value: 1.56e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837   43 VIKAVTNFRQVSKVLEEFDVEEQPGTMLESRFPNIKVIEsGVKQLKSEDhcIFTEDGREFVYKKLCLCAGAKPKLI-YEG 121
Cdd:pfam07992  52 APEIASLWADLYKRKEEVVKKLNNGIEVLLGTEVVSIDP-GAKKVVLEE--LVDGDGETITYDRLVIATGARPRLPpIPG 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  122 --NPRVLGIRDTDSAQEFQKELaKARRIMIVGNGGIALELAYEIE--GCEVVWaIKDNAIGNTFFDAGAAEFLtsklmse 197
Cdd:pfam07992 129 veLNVGFLVRTLDSAEALRLKL-LPKRVVVVGGGYIGVELAAALAklGKEVTL-IEALDRLLRAFDEEISAAL------- 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  198 kseakiahkrtiytvEEAKKEtrtkskadyvgsalgpdwhgglalkgteefsHSVHIETRCEVKKIyleeefkimkkksl 277
Cdd:pfam07992 200 ---------------EKALEK-------------------------------NGVEVRLGTSVKEI-------------- 219
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  278 afpKDHHKSVTadkemwpvyVELTNGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDi 357
Cdd:pfam07992 220 ---IGDGDGVE---------VILKDGTEIDADLVVVAIGRRPN-TELLEAAGLELDERGGIVVDEYLRTSVPGIYAAGD- 285
                         330       340
                  ....*....|....*....|....
gi 110625837  358 ctaCWQPSPvwqqmRLWTQARQMG 381
Cdd:pfam07992 286 ---CRVGGP-----ELAQNAVAQG 301
FadH2 COG0446
NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase ...
21-464 6.52e-15

NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase [Lipid transport and metabolism];


Pssm-ID: 223523 [Multi-domain]  Cd Length: 415  Bit Score: 76.49  E-value: 6.52e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  21 TCAEQLAVSFPEEDILLVTASPviKAVTNFRQVSKVLEE--FDVEEQPGTMLESRFPNIKV-IESGVKQLKSEDHCIFTE 97
Cdd:COG0446   12 SAATTLRRLLLAAEITLIGREP--KYSYYRCPLSLYVGGgiASLEDLRYPPRFNRATGIDVrTGTEVTSIDPENKVVLLD 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  98 DGREFvYKKLCLCAGAKPK-LIYEGNPRVLGIRDTDSAQEFQKELAKARRIMIVGNGGIALELAYEI--EGCEVVWAIKD 174
Cdd:COG0446   90 DGEIE-YDYLVLATGARPRpPPISDWEGVVTLRLREDAEALKGGAEPPKDVVVVGAGPIGLEAAEAAakRGKKVTLIEAA 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 175 NAIGNTFFDAGAAEFLTSKLmsekseakiahkrtiytveeakketrtkskadyvgsalgpDWHGglalkgteefshsVHI 254
Cdd:COG0446  169 DRLGGQLLDPEVAEELAELL----------------------------------------EKYG-------------VEL 195
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 255 ETRCEVKKIYLEEefkimkkkslafpkdhhksvtadKEMWPVYVELTNGTIYGCDFLVSATGVTPNVHPFLHRNNFALGE 334
Cdd:COG0446  196 LLGTKVVGVEGKG-----------------------NTLVVERVVGIDGEEIKADLVIIGPGERPNVVLANDALPGLALA 252
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 335 DGGLRVDDQMRTSL-PDIYAAGDICTACWQPSPVWQQMRLWTQARQMGYyaakcMAAASMGHPIDMDFSFELFahVTKFF 413
Cdd:COG0446  253 GGAVLVDERGGTSKdPDVYAAGDVAEIPAAETGKGGRIALWAIAVAAGR-----IAAENIAGALRIPGLLGTV--ISDVG 325
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|.
gi 110625837 414 NYKVVLLGKYNAQGLGADHELMLRCtrGQEYVKVVMQNGRMMGAVLIGETD 464
Cdd:COG0446  326 DLCAASTGLTEGKERGIDVVLVVSG--GKDPRAHLYPGAELVGIKLVGDAD 374
NirB COG1251
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];
298-492 7.84e-13

NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];


Pssm-ID: 224171 [Multi-domain]  Cd Length: 793  Bit Score: 70.81  E-value: 7.84e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 298 VELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGDiCTAcwqpspvWQQM 371
Cdd:COG1251  222 VRFADGTEIPADLVVMAVGIRPND---------ELAKEAGLAvnrgivVNDYMQTSDPDIYAVGE-CAE-------HRGK 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 372 R------LWTQARqmgyyaakcMAAASMghpidMDFSFELFAHVTKFFNYKVV---LLGKYNAQGLGADHELMLRCTRGQ 442
Cdd:COG1251  285 VyglvapLYEQAK---------VLADHL-----CGGEAEAYEGSVTSTKLKVSgvdVFSAGDFQETEGAESIVFRDEQRG 350
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 110625837 443 EYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNID 492
Cdd:COG1251  351 IYKKLVLKDDKIVGAVLYGDTSDGGWLLDLILKGADISEIRDTLILPQGS 400
PRK04965 PRK04965
NADH:flavorubredoxin reductase NorW;
58-356 8.99e-09

NADH:flavorubredoxin reductase NorW;


Pssm-ID: 179902 [Multi-domain]  Cd Length: 377  Bit Score: 57.23  E-value: 8.99e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  58 EEFDVEEQPGTMLESrfpnikvIESGVKQLKSedhcifteDGREFVYKKLCLCAGAK---PKLiyEGNPRVLGIrdtDSA 134
Cdd:PRK04965  69 EQFNLRLFPHTWVTD-------IDAEAQVVKS--------QGNQWQYDKLVLATGASafvPPI--PGRELMLTL---NSQ 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 135 QEF---QKELAKARRIMIVGNGGIALELAYEI--EGCEVVwaIKDNAigntffdagaaEFLTSKLMSEKSEAKIAHKRTi 209
Cdd:PRK04965 129 QEYraaETQLRDAQRVLVVGGGLIGTELAMDLcrAGKAVT--LVDNA-----------ASLLASLMPPEVSSRLQHRLT- 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 210 ytveeakketrtkskadyvgsalgpdwhgglalkgteefSHSVHIETRCEVKKIyleeefkimkkkslafpkdhhkSVTA 289
Cdd:PRK04965 195 ---------------------------------------EMGVHLLLKSQLQGL----------------------EKTD 213
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110625837 290 DKemwpVYVELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGD 356
Cdd:PRK04965 214 SG----IRATLDSGRSIEVDAVIAAAGLRPNT---------ALARRAGLAvnrgivVDSYLQTSAPDIYALGD 273
PRK13748 PRK13748
putative mercuric reductase; Provisional
308-368 2.62e-08

putative mercuric reductase; Provisional


Pssm-ID: 184298 [Multi-domain]  Cd Length: 561  Bit Score: 56.31  E-value: 2.62e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 110625837 308 CDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTAcwQPSPVW 368
Cdd:PRK13748 354 ADKLLVATGRAPNTRSLaLDAAGVTVNAQGAIVIDQGMRTSVPHIYAAGD-CTD--QPQFVY 412
PRK09754 PRK09754
phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional
63-259 3.71e-08

phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional


Pssm-ID: 170080 [Multi-domain]  Cd Length: 396  Bit Score: 55.32  E-value: 3.71e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  63 EEQPGTMLESRFPNIKVIE--SG--VKQLKSEDHCIFTEDGREFVYKKLCLCAGAKPK---LIYEGNPRVLGIRDTDSAQ 135
Cdd:PRK09754  56 SPQLQQVLPANWWQENNVHlhSGvtIKTLGRDTRELVLTNGESWHWDQLFIATGAAARplpLLDALGERCFTLRHAGDAA 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 136 EFQKELAKARRIMIVGNGGIALELAYEI--EGCEV-VWAIKDNAIG------------NTFFDAGAAEFLTSKLMSEKSE 200
Cdd:PRK09754 136 RLREVLQPERSVVIVGAGTIGLELAASAtqRRCKVtVIELAATVMGrnapppvqryllQRHQQAGVRILLNNAIEHVVDG 215
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 110625837 201 AKIahkrtiytveEAKKETRTKSKADYVGSALGPDWHGGLALKGTEEFSHSVHIETRCE 259
Cdd:PRK09754 216 EKV----------ELTLQSGETLQADVVIYGIGISANDQLAREANLDTANGIVIDEACR 264
Lpd COG1249
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component ...
296-462 5.57e-08

Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component or related enzyme [Energy production and conversion];


Pssm-ID: 224169 [Multi-domain]  Cd Length: 454  Bit Score: 54.91  E-value: 5.57e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 296 VYVELTNG--TIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICTacwqpspvwqQMR 372
Cdd:COG1249  247 VLVTLEDGegGTIEADAVLVAIGRKPNTDGLgLENAGVELDDRGFIKVDDQMTTNVPGIYAIGDVIG----------GPM 316
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 373 LWTQARQMGYYAAKCMAAASMgHPIDMD------FSFELFAHV--------TKFFNYKVvllGKYNAQGLGAdhELMLRC 438
Cdd:COG1249  317 LAHVAMAEGRIAAENIAGGKR-TPIDYRlipsvvFTDPEIASVglteeeakEAGIDYKV---GKFPFAANGR--AITMGE 390
                        170       180
                 ....*....|....*....|....*.
gi 110625837 439 TRGqeYVKVVM--QNGRMMGAVLIGE 462
Cdd:COG1249  391 TDG--FVKLVVdkETGRILGAHIVGP 414
PRK06370 PRK06370
FAD-containing oxidoreductase;
308-358 6.10e-07

FAD-containing oxidoreductase;


Pssm-ID: 235787 [Multi-domain]  Cd Length: 463  Bit Score: 51.74  E-value: 6.10e-07
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 110625837 308 CDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDIC 358
Cdd:PRK06370 260 GSHILVAVGRVPNTDDLgLEAAGVETDARGYIKVDDQLRTTNPGIYAAGDCN 311
Ndh COG1252
NADH dehydrogenase, FAD-containing subunit [Energy production and conversion];
72-441 1.24e-06

NADH dehydrogenase, FAD-containing subunit [Energy production and conversion];


Pssm-ID: 224172 [Multi-domain]  Cd Length: 405  Bit Score: 50.71  E-value: 1.24e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  72 SRFPNIKVIESGVKQLKSEDHCIFTEDGREFVYKKLCLCAGAKPKliYEGNPRV----LGIRDTDSAQEF---------- 137
Cdd:COG1252   68 RKSGNVQFVQGEVTDIDRDAKKVTLADLGEISYDYLVVALGSETN--YFGIPGAaeyaFGLKTLEDALRLrrhlleafek 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 138 --QKELAKARR-IMIVGNG--GIalELAYEIegcevvwaikdnaigntffdAGAAEFLTSKLMSEKSEAKIahkrtiyTV 212
Cdd:COG1252  146 asQEEDDRALLtIVIVGGGptGV--ELAGEL--------------------AERLHRLLKKFRVDPSELRV-------IL 196
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 213 EEAkketrtkskADYVGSALGPDwhggLALKGTEEF-SHSVHIETRCEVKKIylEEEFkimkkkslafpkdhhksvtadk 291
Cdd:COG1252  197 VEA---------GPRILPMFPPK----LSKYAERALeKLGVEVLLGTPVTEV--TPDG---------------------- 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 292 emwpVYVELTNGTIyGCDFLVSATGVTPNvhPFLhRN--NFALGEDGGLRVDDQMR-TSLPDIYAAGDiCTACWQPSPVW 368
Cdd:COG1252  240 ----VTLKDGEEEI-PADTVVWAAGVRAS--PLL-KDlsGLETDRRGRLVVNPTLQvPGHPDIFAAGD-CAAVIDPRPVP 310
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110625837 369 Q--QMrlwtqARQMGYYAAKCMAAASMGHPIDMdfsFELFAHVTkffnykVVLLGKYNAQGLgadheLMLRCTRG 441
Cdd:COG1252  311 PtaQA-----AHQQGEYAAKNIKARLKGKPLKP---FKYKDKGT------LASLGDFSAVAD-----LGGVKLKG 366
TrxB COG0492
Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones];
308-393 2.44e-06

Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223566 [Multi-domain]  Cd Length: 305  Bit Score: 49.21  E-value: 2.44e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 308 CDFLVSATGVTPNVHPFLHRNNfaLGEDGGLRVDDQMRTSLPDIYAAGDICTACWqpspvwqqmRLWTQARQMGyyaakC 387
Cdd:COG0492  227 VDGVFIAIGHLPNTELLKGLGV--LDENGYIVVDEEMETSVPGIFAAGDVADKNG---------RQIATAAGDG-----A 290

                 ....*.
gi 110625837 388 MAAASM 393
Cdd:COG0492  291 IAALSA 296
PRK14989 PRK14989
nitrite reductase subunit NirD; Provisional
302-489 2.64e-06

nitrite reductase subunit NirD; Provisional


Pssm-ID: 184951 [Multi-domain]  Cd Length: 847  Bit Score: 50.12  E-value: 2.64e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 302 NGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTAcwqpspvWQQMRLWTQARqmG 381
Cdd:PRK14989 228 DGSELEVDFIVFSTGIRPQ-DKLATQCGLAVAPRGGIVINDSCQTSDPDIYAIGE-CAS-------WNNRVFGLVAP--G 296
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 382 YYaakcMAAASMGHPIDMDFSFE---LFAHVtKFFNYKVVLLGKYNAQGLGADHELMLrcTRGQEYVK---VVMQNGRMM 455
Cdd:PRK14989 297 YK----MAQVAVDHLLGSENAFEgadLSAKL-KLLGVDVGGIGDAHGRTPGARSYVYL--DESKEIYKrliVSEDNKTLL 369
                        170       180       190
                 ....*....|....*....|....*....|....
gi 110625837 456 GAVLIGETDLEETFENLILNQMDLSSYGEDLLDP 489
Cdd:PRK14989 370 GAVLVGDTSDYGNLLQLVLNAIELPENPDSLILP 403
PRK07818 PRK07818
dihydrolipoamide dehydrogenase; Reviewed
309-476 3.76e-06

dihydrolipoamide dehydrogenase; Reviewed


Pssm-ID: 236106 [Multi-domain]  Cd Length: 466  Bit Score: 49.25  E-value: 3.76e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 309 DFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDIcTAcwqpspvwqQMRLWTQARQMGYYAAKC 387
Cdd:PRK07818 263 DKVLQAIGFAPRVEGYgLEKTGVALTDRGAIAIDDYMRTNVPHIYAIGDV-TA---------KLQLAHVAEAQGVVAAET 332
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 388 MAAASMGHPIDMDF------------SFELFAHVTKFFNYKVVLL-------GKynAQGLGAdhelmlrcTRGqeYVKVV 448
Cdd:PRK07818 333 IAGAETLELGDYRMmpratfcqpqvaSFGLTEEQAREEGYDVKVAkfpftanGK--AHGLGD--------PTG--FVKLV 400
                        170       180       190
                 ....*....|....*....|....*....|
gi 110625837 449 M--QNGRMMGAVLIGEtDLEETFENLILNQ 476
Cdd:PRK07818 401 AdaKYGELLGGHLIGP-DVSELLPELTLAQ 429
PRK09564 PRK09564
coenzyme A disulfide reductase; Reviewed
296-363 5.01e-06

coenzyme A disulfide reductase; Reviewed


Pssm-ID: 181958 [Multi-domain]  Cd Length: 444  Bit Score: 48.88  E-value: 5.01e-06
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 110625837 296 VYVELTNGTIYGCDFLVSATGVTPNVHpFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTACWQ 363
Cdd:PRK09564 223 VEGVVTDKGEYEADVVIVATGVKPNTE-FLEDTGLKTLKNGAIIVDEYGETSIENIYAAGD-CATIYN 288
PRK07251 PRK07251
FAD-containing oxidoreductase;
259-357 8.65e-06

FAD-containing oxidoreductase;


Pssm-ID: 180907 [Multi-domain]  Cd Length: 438  Bit Score: 47.82  E-value: 8.65e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 259 EVKKIYLEEEfkimkkkSLAFPKDHHKSVTADKEMWPVYVelTNGTIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGG 337
Cdd:PRK07251 202 ALAKQYMEED-------GITFLLNAHTTEVKNDGDQVLVV--TEDETYRFDALLYATGRKPNTEPLgLENTDIELTERGA 272
                         90       100
                 ....*....|....*....|
gi 110625837 338 LRVDDQMRTSLPDIYAAGDI 357
Cdd:PRK07251 273 IKVDDYCQTSVPGVFAVGDV 292
PRK06116 PRK06116
glutathione reductase; Validated
298-357 1.25e-05

glutathione reductase; Validated


Pssm-ID: 235701 [Multi-domain]  Cd Length: 450  Bit Score: 47.46  E-value: 1.25e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 110625837 298 VELTNGTIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDI 357
Cdd:PRK06116 244 LTLEDGETLTVDCLIWAIGREPNTDGLgLENAGVKLNEKGYIIVDEYQNTNVPGIYAVGDV 304
PRK06416 PRK06416
dihydrolipoamide dehydrogenase; Reviewed
309-357 4.76e-05

dihydrolipoamide dehydrogenase; Reviewed


Pssm-ID: 235798 [Multi-domain]  Cd Length: 462  Bit Score: 45.52  E-value: 4.76e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 110625837 309 DFLVSATGVTPNVhpflhrNNFALGE-----DGGL-RVDDQMRTSLPDIYAAGDI 357
Cdd:PRK06416 262 DYVLVAVGRRPNT------ENLGLEElgvktDRGFiEVDEQLRTNVPNIYAIGDI 310
PRK13512 PRK13512
coenzyme A disulfide reductase; Provisional
298-421 4.80e-05

coenzyme A disulfide reductase; Provisional


Pssm-ID: 184103 [Multi-domain]  Cd Length: 438  Bit Score: 45.54  E-value: 4.80e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 298 VELTNGTIYGCDFLVSATGVTPNVHpFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICTACWQPSPVWQQMRL-Wtq 376
Cdd:PRK13512 220 VTFKSGKVEHYDMIIEGVGTHPNSK-FIESSNIKLDDKGFIPVNDKFETNVPNIYAIGDIITSHYRHVDLPASVPLaW-- 296
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 110625837 377 arqmGYYAAKCMAAASMGHPIDMDFSFELFAHVTKFFNYKVVLLG 421
Cdd:PRK13512 297 ----GAHRAASIVAEQIAGNDTIEFKGFLGNNIVKFFDYTFASVG 337
PRK07846 PRK07846
mycothione reductase; Reviewed
296-359 4.93e-05

mycothione reductase; Reviewed


Pssm-ID: 181142 [Multi-domain]  Cd Length: 451  Bit Score: 45.72  E-value: 4.93e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110625837 296 VYVELTNGTIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICT 359
Cdd:PRK07846 239 VTLRLDDGSTVEADVLLVATGRVPNGDLLdAAAAGVDVDEDGRVVVDEYQRTSAEGVFALGDVSS 303
PRK07845 PRK07845
flavoprotein disulfide reductase; Reviewed
296-359 5.00e-05

flavoprotein disulfide reductase; Reviewed


Pssm-ID: 236112 [Multi-domain]  Cd Length: 466  Bit Score: 45.62  E-value: 5.00e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 110625837 296 VYVELTNG-TIYGCDFLVsATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCT 359
Cdd:PRK07845 251 VVVTLTDGrTVEGSHALM-AVGSVPNTAGLgLEEAGVELTPSGHITVDRVSRTSVPGIYAAGD-CT 314
PRK14694 PRK14694
putative mercuric reductase; Provisional
296-368 1.05e-04

putative mercuric reductase; Provisional


Pssm-ID: 237790 [Multi-domain]  Cd Length: 468  Bit Score: 44.55  E-value: 1.05e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 110625837 296 VYVELTNGTIYGCDFLVSATGVTPNVHPFlhrNNFALG---EDGGLRVDDQMRTSLPDIYAAGDiCTAcwQPSPVW 368
Cdd:PRK14694 250 EFILETNAGTLRAEQLLVATGRTPNTENL---NLESIGvetERGAIRIDEHLQTTVSGIYAAGD-CTD--QPQFVY 319
PRK11749 PRK11749
dihydropyrimidine dehydrogenase subunit A; Provisional
308-359 1.16e-04

dihydropyrimidine dehydrogenase subunit A; Provisional


Pssm-ID: 236967 [Multi-domain]  Cd Length: 457  Bit Score: 44.40  E-value: 1.16e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 110625837 308 CDFLVSATGVTPNVHPFLHRNNFALGEDGGLRVDDQ-MRTSLPDIYAAGDICT 359
Cdd:PRK11749 376 ADLVIKAIGQTPNPLILSTTPGLELNRWGTIIADDEtGRTSLPGVFAGGDIVT 428
PTZ00318 PTZ00318
NADH dehydrogenase-like protein; Provisional
259-430 2.41e-04

NADH dehydrogenase-like protein; Provisional


Pssm-ID: 185553 [Multi-domain]  Cd Length: 424  Bit Score: 43.22  E-value: 2.41e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 259 EVKKIYLEEEFKI-------MKKKSLAFPKDHHKSV---TADKEMWPVYVELTNGTIYGCDFLVSATGVTPnvHPFLHRN 328
Cdd:PTZ00318 210 ECKVTVLEAGSEVlgsfdqaLRKYGQRRLRRLGVDIrtkTAVKEVLDKEVVLKDGEVIPTGLVVWSTGVGP--GPLTKQL 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 329 NFALGEDGGLRVDDQMRTS-LPDIYAAGDICTACWQPSPVWQQMrlwtqARQMGYYAAKCMAAASMGHPIDMDFSFELFA 407
Cdd:PTZ00318 288 KVDKTSRGRISVDDHLRVKpIPNVFALGDCAANEERPLPTLAQV-----ASQQGVYLAKEFNNELKGKPMSKPFVYRSLG 362
                        170       180
                 ....*....|....*....|....
gi 110625837 408 HVTKFFNYK-VVLLGKYNAQGLGA 430
Cdd:PTZ00318 363 SLAYLGNYSaIVQLGAFDLSGFKA 386
PRK06292 PRK06292
dihydrolipoamide dehydrogenase; Validated
264-357 3.53e-04

dihydrolipoamide dehydrogenase; Validated


Pssm-ID: 235774 [Multi-domain]  Cd Length: 460  Bit Score: 42.86  E-value: 3.53e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 264 YLEEEFKImkkkslaFPKDHHKSVTADKEMWPVYVELTNGTIY-GCDFLVSATGVTPNV-HPFLHRNNFALGEDGGLRVD 341
Cdd:PRK06292 219 ILSKEFKI-------KLGAKVTSVEKSGDEKVEELEKGGKTETiEADYVLVATGRRPNTdGLGLENTGIELDERGRPVVD 291
                         90
                 ....*....|....*.
gi 110625837 342 DQMRTSLPDIYAAGDI 357
Cdd:PRK06292 292 EHTQTSVPGIYAAGDV 307
PRK12778 PRK12778
bifunctional dihydroorotate dehydrogenase B NAD binding subunit/NADPH-dependent glutamate ...
295-359 8.60e-04

bifunctional dihydroorotate dehydrogenase B NAD binding subunit/NADPH-dependent glutamate synthase;


Pssm-ID: 237200 [Multi-domain]  Cd Length: 752  Bit Score: 42.04  E-value: 8.60e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 110625837 295 PVYVELTNGTIyGCDFLVSATGVTPNvhPFLHRN--NFALGEDGGLRVDDQMRTSLPDIYAAGDICT 359
Cdd:PRK12778 663 PVAIPGSTFTV-DVDLVIVSVGVSPN--PLVPSSipGLELNRKGTIVVDEEMQSSIPGIYAGGDIVR 726
PRK06467 PRK06467
dihydrolipoamide dehydrogenase; Reviewed
309-357 1.36e-03

dihydrolipoamide dehydrogenase; Reviewed


Pssm-ID: 180579 [Multi-domain]  Cd Length: 471  Bit Score: 41.09  E-value: 1.36e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 110625837 309 DFLVSATGVTPNVHPFL-HRNNFALGEDGGLRVDDQMRTSLPDIYAAGDI 357
Cdd:PRK06467 264 DAVLVAVGRVPNGKLLDaEKAGVEVDERGFIRVDKQCRTNVPHIFAIGDI 313
PRK05249 PRK05249
Si-specific NAD(P)(+) transhydrogenase;
296-357 1.48e-03

Si-specific NAD(P)(+) transhydrogenase;


Pssm-ID: 235373 [Multi-domain]  Cd Length: 461  Bit Score: 40.91  E-value: 1.48e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 110625837 296 VYVELTNGTIYGCDFLVSATGVTPNVHPfLHRNNFALGED--GGLRVDDQMRTSLPDIYAAGDI 357
Cdd:PRK05249 249 VIVHLKSGKKIKADCLLYANGRTGNTDG-LNLENAGLEADsrGQLKVNENYQTAVPHIYAVGDV 311
PTZ00058 PTZ00058
glutathione reductase; Provisional
97-358 1.79e-03

glutathione reductase; Provisional


Pssm-ID: 185420 [Multi-domain]  Cd Length: 561  Bit Score: 40.75  E-value: 1.79e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837  97 EDGREFVYKKLCLCAGAKPKLiyegnPRVLGIRDTDSAQEFQKeLAKARRIMIVGNGGIALELAyeiegcevvwaikdna 176
Cdd:PTZ00058 196 DDGQVIEGKNILIAVGNKPIF-----PDVKGKEFTISSDDFFK-IKEAKRIGIAGSGYIAVELI---------------- 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 177 igNTFFDAGAAEFLTSKlmsekseakiAHKRTIYTVEEAKKETRTKSKADyvgsalgpdwhgglalkgteefshSVHIET 256
Cdd:PTZ00058 254 --NVVNRLGAESYIFAR----------GNRLLRKFDETIINELENDMKKN------------------------NINIIT 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625837 257 RCEVKKIYLEEEfkimkKKSLAFPKDHHKSVTADkemwpvyveltngtiygcdFLVSATGVTPNVHPFLHRNNFALGEDG 336
Cdd:PTZ00058 298 HANVEEIEKVKE-----KNLTIYLSDGRKYEHFD-------------------YVIYCVGRSPNTEDLNLKALNIKTPKG 353
                        250       260
                 ....*....|....*....|..
gi 110625837 337 GLRVDDQMRTSLPDIYAAGDIC 358
Cdd:PTZ00058 354 YIKVDDNQRTSVKHIYAVGDCC 375
PRK14727 PRK14727
putative mercuric reductase; Provisional
308-359 2.42e-03

putative mercuric reductase; Provisional


Pssm-ID: 237806 [Multi-domain]  Cd Length: 479  Bit Score: 40.31  E-value: 2.42e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 110625837 308 CDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCT 359
Cdd:PRK14727 272 AEKLLISTGRHANTHDLnLEAVGVTTDTSGAIVVNPAMETSAPDIYAAGD-CS 323
PRK06327 PRK06327
dihydrolipoamide dehydrogenase; Validated
308-357 5.13e-03

dihydrolipoamide dehydrogenase; Validated


Pssm-ID: 235779 [Multi-domain]  Cd Length: 475  Bit Score: 39.14  E-value: 5.13e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 110625837 308 CDFLVSATGVTPNVHPFLHRN-NFALGEDGGLRVDDQMRTSLPDIYAAGDI 357
Cdd:PRK06327 273 VDKLIVSIGRVPNTDGLGLEAvGLKLDERGFIPVDDHCRTNVPNVYAIGDV 323
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH