NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568912498|ref|XP_006497583|]
View 

protein FAM107B isoform X3 [Mus musculus]

Protein Classification

protein FAM107A/FAM107B (domain architecture ID 10535143)

protein FAM107A/FAM107B may play a role in tumor development

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF1151 pfam06625
Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic ...
37-148 1.53e-43

Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic proteins of unknown function.


:

Pssm-ID: 399548  Cd Length: 114  Bit Score: 139.68  E-value: 1.53e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568912498   37 DDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQK--EEEAQKKKSDLEIELLK 114
Cdd:pfam06625   1 TDDDGLIKPKKLANPVLASPSHQELHRELLFNHKRGLVLEQKPELQRVLEKRKRDQVLKQKkeEEEAKKKRSDLEQELLK 80
                          90       100       110
                  ....*....|....*....|....*....|....
gi 568912498  115 RQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR 148
Cdd:pfam06625  81 RQQRLEELEKEQEKQREEQENNPEFVRVKENLRR 114
 
Name Accession Description Interval E-value
DUF1151 pfam06625
Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic ...
37-148 1.53e-43

Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic proteins of unknown function.


Pssm-ID: 399548  Cd Length: 114  Bit Score: 139.68  E-value: 1.53e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568912498   37 DDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQK--EEEAQKKKSDLEIELLK 114
Cdd:pfam06625   1 TDDDGLIKPKKLANPVLASPSHQELHRELLFNHKRGLVLEQKPELQRVLEKRKRDQVLKQKkeEEEAKKKRSDLEQELLK 80
                          90       100       110
                  ....*....|....*....|....*....|....
gi 568912498  115 RQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR 148
Cdd:pfam06625  81 RQQRLEELEKEQEKQREEQENNPEFVRVKENLRR 114
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
63-138 9.81e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 38.16  E-value: 9.81e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568912498  63 RELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPE 138
Cdd:COG4942  170 LKQLAAVRAEIAAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEA 245
PRK12704 PRK12704
phosphodiesterase; Provisional
80-134 4.23e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 36.29  E-value: 4.23e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 568912498  80 ELQKvMEKR--RRDQVIKQKEEEAQKKKSDLEI---ELLKRQQKLEQLELEKQKLQEEQE 134
Cdd:PRK12704  83 ELQK-LEKRllQKEENLDRKLELLEKREEELEKkekELEQKQQELEKKEEELEELIEEQL 141
 
Name Accession Description Interval E-value
DUF1151 pfam06625
Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic ...
37-148 1.53e-43

Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic proteins of unknown function.


Pssm-ID: 399548  Cd Length: 114  Bit Score: 139.68  E-value: 1.53e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568912498   37 DDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQK--EEEAQKKKSDLEIELLK 114
Cdd:pfam06625   1 TDDDGLIKPKKLANPVLASPSHQELHRELLFNHKRGLVLEQKPELQRVLEKRKRDQVLKQKkeEEEAKKKRSDLEQELLK 80
                          90       100       110
                  ....*....|....*....|....*....|....
gi 568912498  115 RQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR 148
Cdd:pfam06625  81 RQQRLEELEKEQEKQREEQENNPEFVRVKENLRR 114
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
63-138 9.81e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 38.16  E-value: 9.81e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568912498  63 RELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPE 138
Cdd:COG4942  170 LKQLAAVRAEIAAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEA 245
PRK12704 PRK12704
phosphodiesterase; Provisional
80-134 4.23e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 36.29  E-value: 4.23e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 568912498  80 ELQKvMEKR--RRDQVIKQKEEEAQKKKSDLEI---ELLKRQQKLEQLELEKQKLQEEQE 134
Cdd:PRK12704  83 ELQK-LEKRllQKEENLDRKLELLEKREEELEKkekELEQKQQELEKKEEELEELIEEQL 141
PLN00185 PLN00185
60S ribosomal protein L4-1; Provisional
19-118 9.05e-03

60S ribosomal protein L4-1; Provisional


Pssm-ID: 177779  Cd Length: 405  Bit Score: 35.55  E-value: 9.05e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568912498  19 KDSCLIPRNIMAEPDYIEDDNPELIrpQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKE 98
Cdd:PLN00185 279 KKGYVLPRAKMVNADLARIINSDEV--QSVVNPIKKDVKRAPLKKNPLKNLNAMLKLNPYAKTARRMALLAEAARVKAKK 356
                         90       100
                 ....*....|....*....|...
gi 568912498  99 EEAQKKKSDL---EIELLKRQQK 118
Cdd:PLN00185 357 EKLAKKRKQVskeEAAAIKAAGK 379
tolA PRK09510
cell envelope integrity inner membrane protein TolA; Provisional
95-138 9.35e-03

cell envelope integrity inner membrane protein TolA; Provisional


Pssm-ID: 236545 [Multi-domain]  Cd Length: 387  Bit Score: 35.55  E-value: 9.35e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 568912498  95 KQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPE 138
Cdd:PRK09510  79 EQRKKKEQQQAEELQQKQAAEQERLKQLEKERLAAQEQKKQAEE 122
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH