NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568933535|ref|XP_006503685|]
View 

spondin-2 isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Spond_N pfam06468
Spondin_N; This conserved region is found at the in the N-terminal half of several Spondin ...
40-227 4.79e-112

Spondin_N; This conserved region is found at the in the N-terminal half of several Spondin proteins. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells.


:

Pssm-ID: 399462  Cd Length: 185  Bit Score: 322.61  E-value: 4.79e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568933535   40 ARYSITFIGKWSQTAFPKQYPLFRPpaQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEaagEKLQSV 119
Cdd:pfam06468   1 AKYELTFEGLWSRTTHPKDYPLWRP--HWSDLIGASHSSDYRLWEYGEYASEGVKQFAEWGSTKKLETELK---SESDGV 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568933535  120 HAVFSAPAI-PSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCE-GGRWKEQVVLDLYPHDAGTDSGFTFS 197
Cdd:pfam06468  76 RTIIKAPGIwPNGTGKTSAEFRVDRNHHLVSLVSMIGPSPDWFVGVDSLNLCLkNCTWIDEKTLDLYPWDAGTDSGFTYT 155
                         170       180       190
                  ....*....|....*....|....*....|
gi 568933535  198 SPNFATIPQDTVTEITASSPSHPANSFYYP 227
Cdd:pfam06468 156 SPNFPTIPQEPIRRITSSYPNHPASPFYYP 185
TSP1_spondin pfam19028
Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an ...
277-329 1.21e-17

Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an alternative disulphide binding pattern compared to the canonical TSP1 domain.


:

Pssm-ID: 408798  Cd Length: 52  Bit Score: 75.38  E-value: 1.21e-17
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 568933535  277 CEVSLWSSWGLCGGPCGKlGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNC 329
Cdd:pfam19028   1 CVVSEWSEWSECSKTCGG-GVQTRTRTVIVEPQNGGRPCPELLERRPCNGPPC 52
 
Name Accession Description Interval E-value
Spond_N pfam06468
Spondin_N; This conserved region is found at the in the N-terminal half of several Spondin ...
40-227 4.79e-112

Spondin_N; This conserved region is found at the in the N-terminal half of several Spondin proteins. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells.


Pssm-ID: 399462  Cd Length: 185  Bit Score: 322.61  E-value: 4.79e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568933535   40 ARYSITFIGKWSQTAFPKQYPLFRPpaQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEaagEKLQSV 119
Cdd:pfam06468   1 AKYELTFEGLWSRTTHPKDYPLWRP--HWSDLIGASHSSDYRLWEYGEYASEGVKQFAEWGSTKKLETELK---SESDGV 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568933535  120 HAVFSAPAI-PSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCE-GGRWKEQVVLDLYPHDAGTDSGFTFS 197
Cdd:pfam06468  76 RTIIKAPGIwPNGTGKTSAEFRVDRNHHLVSLVSMIGPSPDWFVGVDSLNLCLkNCTWIDEKTLDLYPWDAGTDSGFTYT 155
                         170       180       190
                  ....*....|....*....|....*....|
gi 568933535  198 SPNFATIPQDTVTEITASSPSHPANSFYYP 227
Cdd:pfam06468 156 SPNFPTIPQEPIRRITSSYPNHPASPFYYP 185
TSP1_spondin pfam19028
Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an ...
277-329 1.21e-17

Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an alternative disulphide binding pattern compared to the canonical TSP1 domain.


Pssm-ID: 408798  Cd Length: 52  Bit Score: 75.38  E-value: 1.21e-17
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 568933535  277 CEVSLWSSWGLCGGPCGKlGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNC 329
Cdd:pfam19028   1 CVVSEWSEWSECSKTCGG-GVQTRTRTVIVEPQNGGRPCPELLERRPCNGPPC 52
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
279-329 6.18e-07

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 45.66  E-value: 6.18e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 568933535   279 VSLWSSWGLCGGPCGKlGAKSRTRY-VRVQPANNGTPCPELEEEAE-CAPDNC 329
Cdd:smart00209   1 WSEWSEWSPCSVTCGG-GVQTRTRScCSPPPQNGGGPCTGEDVETRaCNEQPC 52
 
Name Accession Description Interval E-value
Spond_N pfam06468
Spondin_N; This conserved region is found at the in the N-terminal half of several Spondin ...
40-227 4.79e-112

Spondin_N; This conserved region is found at the in the N-terminal half of several Spondin proteins. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells.


Pssm-ID: 399462  Cd Length: 185  Bit Score: 322.61  E-value: 4.79e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568933535   40 ARYSITFIGKWSQTAFPKQYPLFRPpaQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEaagEKLQSV 119
Cdd:pfam06468   1 AKYELTFEGLWSRTTHPKDYPLWRP--HWSDLIGASHSSDYRLWEYGEYASEGVKQFAEWGSTKKLETELK---SESDGV 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568933535  120 HAVFSAPAI-PSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCE-GGRWKEQVVLDLYPHDAGTDSGFTFS 197
Cdd:pfam06468  76 RTIIKAPGIwPNGTGKTSAEFRVDRNHHLVSLVSMIGPSPDWFVGVDSLNLCLkNCTWIDEKTLDLYPWDAGTDSGFTYT 155
                         170       180       190
                  ....*....|....*....|....*....|
gi 568933535  198 SPNFATIPQDTVTEITASSPSHPANSFYYP 227
Cdd:pfam06468 156 SPNFPTIPQEPIRRITSSYPNHPASPFYYP 185
TSP1_spondin pfam19028
Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an ...
277-329 1.21e-17

Spondin-like TSP1 domain; This entry represents a sub-type of TSP1 domains that have an alternative disulphide binding pattern compared to the canonical TSP1 domain.


Pssm-ID: 408798  Cd Length: 52  Bit Score: 75.38  E-value: 1.21e-17
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 568933535  277 CEVSLWSSWGLCGGPCGKlGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNC 329
Cdd:pfam19028   1 CVVSEWSEWSECSKTCGG-GVQTRTRTVIVEPQNGGRPCPELLERRPCNGPPC 52
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
279-329 6.18e-07

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 45.66  E-value: 6.18e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 568933535   279 VSLWSSWGLCGGPCGKlGAKSRTRY-VRVQPANNGTPCPELEEEAE-CAPDNC 329
Cdd:smart00209   1 WSEWSEWSPCSVTCGG-GVQTRTRScCSPPPQNGGGPCTGEDVETRaCNEQPC 52
TSP_1 pfam00090
Thrombospondin type 1 domain;
280-329 1.60e-03

Thrombospondin type 1 domain;


Pssm-ID: 395043  Cd Length: 49  Bit Score: 35.85  E-value: 1.60e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568933535  280 SLWSSWGLCGGPCGKlGAKSRTRYVrVQPANNGTPCPELEEEAE-CAPDNC 329
Cdd:pfam00090   1 SPWSPWSPCSVTCGK-GIQVRQRTC-KSPKPGGEPCTGDDIETQaCKMDKC 49
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH