NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568944200|ref|XP_006507017|]
View 

pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Pyr_redox_2 super family cl39093
Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II ...
28-313 6.85e-19

Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.


The actual alignment was detected with superfamily member pfam07992:

Pssm-ID: 423044 [Multi-domain]  Cd Length: 301  Bit Score: 86.60  E-value: 6.85e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200   28 TEDGREFVYKKLCLCAGAKPKLI-YEG--NPRVLGIRDTDSAQEFQKELaKARRIMIVGNGGIALELAYEIE--GCEVVW 102
Cdd:pfam07992 102 DGDGETITYDRLVIATGARPRLPpIPGveLNVGFLVRTLDSAEALRLKL-LPKRVVVVGGGYIGVELAAALAklGKEVTL 180
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  103 aIKDNAIGNTFFDAGAAEFLtsklmsekseakiahkrtiytvEEAKKEtrtkskadyvgsalgpdwhgglalkgteefsH 182
Cdd:pfam07992 181 -IEALDRLLRAFDEEISAAL----------------------EKALEK-------------------------------N 206
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  183 SVHIETRCEVKKIyleeefkimkkkslafpKDHHKSVTadkemwpvyVELTNGTIYGCDFLVSATGVTPNvHPFLHRNNF 262
Cdd:pfam07992 207 GVEVRLGTSVKEI-----------------IGDGDGVE---------VILKDGTEIDADLVVVAIGRRPN-TELLEAAGL 259
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568944200  263 ALGEDGGLRVDDQMRTSLPDIYAAGDictaCWQPSPvwqqmRLWTQARQMG 313
Cdd:pfam07992 260 ELDERGGIVVDEYLRTSVPGIYAAGD----CRVGGP-----ELAQNAVAQG 301
NirB super family cl34210
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];
230-424 6.69e-13

NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];


The actual alignment was detected with superfamily member COG1251:

Pssm-ID: 224171 [Multi-domain]  Cd Length: 793  Bit Score: 70.42  E-value: 6.69e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 230 VELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGDiCTAcwqpspvWQQM 303
Cdd:COG1251  222 VRFADGTEIPADLVVMAVGIRPND---------ELAKEAGLAvnrgivVNDYMQTSDPDIYAVGE-CAE-------HRGK 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 304 R------LWTQARqmgyyaakcMAAASMghpidMDFSFELFAHVTKFFNYKVV---LLGKYNAQGLGADHELMLRCTRGQ 374
Cdd:COG1251  285 VyglvapLYEQAK---------VLADHL-----CGGEAEAYEGSVTSTKLKVSgvdVFSAGDFQETEGAESIVFRDEQRG 350
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 568944200 375 EYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNID 424
Cdd:COG1251  351 IYKKLVLKDDKIVGAVLYGDTSDGGWLLDLILKGADISEIRDTLILPQGS 400
 
Name Accession Description Interval E-value
Pyr_redox_2 pfam07992
Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II ...
28-313 6.85e-19

Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.


Pssm-ID: 400379 [Multi-domain]  Cd Length: 301  Bit Score: 86.60  E-value: 6.85e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200   28 TEDGREFVYKKLCLCAGAKPKLI-YEG--NPRVLGIRDTDSAQEFQKELaKARRIMIVGNGGIALELAYEIE--GCEVVW 102
Cdd:pfam07992 102 DGDGETITYDRLVIATGARPRLPpIPGveLNVGFLVRTLDSAEALRLKL-LPKRVVVVGGGYIGVELAAALAklGKEVTL 180
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  103 aIKDNAIGNTFFDAGAAEFLtsklmsekseakiahkrtiytvEEAKKEtrtkskadyvgsalgpdwhgglalkgteefsH 182
Cdd:pfam07992 181 -IEALDRLLRAFDEEISAAL----------------------EKALEK-------------------------------N 206
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  183 SVHIETRCEVKKIyleeefkimkkkslafpKDHHKSVTadkemwpvyVELTNGTIYGCDFLVSATGVTPNvHPFLHRNNF 262
Cdd:pfam07992 207 GVEVRLGTSVKEI-----------------IGDGDGVE---------VILKDGTEIDADLVVVAIGRRPN-TELLEAAGL 259
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568944200  263 ALGEDGGLRVDDQMRTSLPDIYAAGDictaCWQPSPvwqqmRLWTQARQMG 313
Cdd:pfam07992 260 ELDERGGIVVDEYLRTSVPGIYAAGD----CRVGGP-----ELAQNAVAQG 301
FadH2 COG0446
NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase ...
8-396 1.37e-14

NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase [Lipid transport and metabolism];


Pssm-ID: 223523 [Multi-domain]  Cd Length: 415  Bit Score: 74.95  E-value: 1.37e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200   8 NIKV-IESGVKQLKSEDHCIFTEDGREFvYKKLCLCAGAKPK-LIYEGNPRVLGIRDTDSAQEFQKELAKARRIMIVGNG 85
Cdd:COG0446   67 GIDVrTGTEVTSIDPENKVVLLDDGEIE-YDYLVLATGARPRpPPISDWEGVVTLRLREDAEALKGGAEPPKDVVVVGAG 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  86 GIALELAYEI--EGCEVVWAIKDNAIGNTFFDAGAAEFLTSKLmsekseakiahkrtiytveeakketrtkskadyvgsa 163
Cdd:COG0446  146 PIGLEAAEAAakRGKKVTLIEAADRLGGQLLDPEVAEELAELL------------------------------------- 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 164 lgpDWHGglalkgteefshsVHIETRCEVKKIYLEEefkimkkkslafpkdhhksvtadKEMWPVYVELTNGTIYGCDFL 243
Cdd:COG0446  189 ---EKYG-------------VELLLGTKVVGVEGKG-----------------------NTLVVERVVGIDGEEIKADLV 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 244 VSATGVTPNVHPFLHRNNFALGEDGGLRVDDQMRTSL-PDIYAAGDICTACWQPSPVWQQMRLWTQARQMGYyaakcMAA 322
Cdd:COG0446  230 IIGPGERPNVVLANDALPGLALAGGAVLVDERGGTSKdPDVYAAGDVAEIPAAETGKGGRIALWAIAVAAGR-----IAA 304
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568944200 323 ASMGHPIDMDFSFELFahVTKFFNYKVVLLGKYNAQGLGADHELMLRCtrGQEYVKVVMQNGRMMGAVLIGETD 396
Cdd:COG0446  305 ENIAGALRIPGLLGTV--ISDVGDLCAASTGLTEGKERGIDVVLVVSG--GKDPRAHLYPGAELVGIKLVGDAD 374
NirB COG1251
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];
230-424 6.69e-13

NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];


Pssm-ID: 224171 [Multi-domain]  Cd Length: 793  Bit Score: 70.42  E-value: 6.69e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 230 VELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGDiCTAcwqpspvWQQM 303
Cdd:COG1251  222 VRFADGTEIPADLVVMAVGIRPND---------ELAKEAGLAvnrgivVNDYMQTSDPDIYAVGE-CAE-------HRGK 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 304 R------LWTQARqmgyyaakcMAAASMghpidMDFSFELFAHVTKFFNYKVV---LLGKYNAQGLGADHELMLRCTRGQ 374
Cdd:COG1251  285 VyglvapLYEQAK---------VLADHL-----CGGEAEAYEGSVTSTKLKVSgvdVFSAGDFQETEGAESIVFRDEQRG 350
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 568944200 375 EYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNID 424
Cdd:COG1251  351 IYKKLVLKDDKIVGAVLYGDTSDGGWLLDLILKGADISEIRDTLILPQGS 400
PRK04965 PRK04965
NADH:flavorubredoxin reductase NorW;
16-288 9.55e-09

NADH:flavorubredoxin reductase NorW;


Pssm-ID: 179902 [Multi-domain]  Cd Length: 377  Bit Score: 56.85  E-value: 9.55e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  16 VKQLKSEDHCIFTeDGREFVYKKLCLCAGAK---PKLiyEGNPRVLGIrdtDSAQEF---QKELAKARRIMIVGNGGIAL 89
Cdd:PRK04965  81 VTDIDAEAQVVKS-QGNQWQYDKLVLATGASafvPPI--PGRELMLTL---NSQQEYraaETQLRDAQRVLVVGGGLIGT 154
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  90 ELAYEI--EGCEVVwaIKDNAigntffdagaaEFLTSKLMSEKSEAKIAHKRTiytveeakketrtkskadyvgsalgpd 167
Cdd:PRK04965 155 ELAMDLcrAGKAVT--LVDNA-----------ASLLASLMPPEVSSRLQHRLT--------------------------- 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 168 whgglalkgteefSHSVHIETRCEVKKIyleeefkimkkkslafpkdhhkSVTADKemwpVYVELTNGTIYGCDFLVSAT 247
Cdd:PRK04965 195 -------------EMGVHLLLKSQLQGL----------------------EKTDSG----IRATLDSGRSIEVDAVIAAA 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 568944200 248 GVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGD 288
Cdd:PRK04965 236 GLRPNT---------ALARRAGLAvnrgivVDSYLQTSAPDIYALGD 273
PRK14989 PRK14989
nitrite reductase subunit NirD; Provisional
234-421 2.42e-06

nitrite reductase subunit NirD; Provisional


Pssm-ID: 184951 [Multi-domain]  Cd Length: 847  Bit Score: 49.73  E-value: 2.42e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 234 NGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTAcwqpspvWQQMRLWTQARqmG 313
Cdd:PRK14989 228 DGSELEVDFIVFSTGIRPQ-DKLATQCGLAVAPRGGIVINDSCQTSDPDIYAIGE-CAS-------WNNRVFGLVAP--G 296
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 314 YYaakcMAAASMGHPIDMDFSFE---LFAHVtKFFNYKVVLLGKYNAQGLGADHELMLrcTRGQEYVK---VVMQNGRMM 387
Cdd:PRK14989 297 YK----MAQVAVDHLLGSENAFEgadLSAKL-KLLGVDVGGIGDAHGRTPGARSYVYL--DESKEIYKrliVSEDNKTLL 369
                        170       180       190
                 ....*....|....*....|....*....|....
gi 568944200 388 GAVLIGETDLEETFENLILNQMDLSSYGEDLLDP 421
Cdd:PRK14989 370 GAVLVGDTSDYGNLLQLVLNAIELPENPDSLILP 403
 
Name Accession Description Interval E-value
Pyr_redox_2 pfam07992
Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II ...
28-313 6.85e-19

Pyridine nucleotide-disulphide oxidoreductase; This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.


Pssm-ID: 400379 [Multi-domain]  Cd Length: 301  Bit Score: 86.60  E-value: 6.85e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200   28 TEDGREFVYKKLCLCAGAKPKLI-YEG--NPRVLGIRDTDSAQEFQKELaKARRIMIVGNGGIALELAYEIE--GCEVVW 102
Cdd:pfam07992 102 DGDGETITYDRLVIATGARPRLPpIPGveLNVGFLVRTLDSAEALRLKL-LPKRVVVVGGGYIGVELAAALAklGKEVTL 180
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  103 aIKDNAIGNTFFDAGAAEFLtsklmsekseakiahkrtiytvEEAKKEtrtkskadyvgsalgpdwhgglalkgteefsH 182
Cdd:pfam07992 181 -IEALDRLLRAFDEEISAAL----------------------EKALEK-------------------------------N 206
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  183 SVHIETRCEVKKIyleeefkimkkkslafpKDHHKSVTadkemwpvyVELTNGTIYGCDFLVSATGVTPNvHPFLHRNNF 262
Cdd:pfam07992 207 GVEVRLGTSVKEI-----------------IGDGDGVE---------VILKDGTEIDADLVVVAIGRRPN-TELLEAAGL 259
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568944200  263 ALGEDGGLRVDDQMRTSLPDIYAAGDictaCWQPSPvwqqmRLWTQARQMG 313
Cdd:pfam07992 260 ELDERGGIVVDEYLRTSVPGIYAAGD----CRVGGP-----ELAQNAVAQG 301
FadH2 COG0446
NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase ...
8-396 1.37e-14

NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase [Lipid transport and metabolism];


Pssm-ID: 223523 [Multi-domain]  Cd Length: 415  Bit Score: 74.95  E-value: 1.37e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200   8 NIKV-IESGVKQLKSEDHCIFTEDGREFvYKKLCLCAGAKPK-LIYEGNPRVLGIRDTDSAQEFQKELAKARRIMIVGNG 85
Cdd:COG0446   67 GIDVrTGTEVTSIDPENKVVLLDDGEIE-YDYLVLATGARPRpPPISDWEGVVTLRLREDAEALKGGAEPPKDVVVVGAG 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  86 GIALELAYEI--EGCEVVWAIKDNAIGNTFFDAGAAEFLTSKLmsekseakiahkrtiytveeakketrtkskadyvgsa 163
Cdd:COG0446  146 PIGLEAAEAAakRGKKVTLIEAADRLGGQLLDPEVAEELAELL------------------------------------- 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 164 lgpDWHGglalkgteefshsVHIETRCEVKKIYLEEefkimkkkslafpkdhhksvtadKEMWPVYVELTNGTIYGCDFL 243
Cdd:COG0446  189 ---EKYG-------------VELLLGTKVVGVEGKG-----------------------NTLVVERVVGIDGEEIKADLV 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 244 VSATGVTPNVHPFLHRNNFALGEDGGLRVDDQMRTSL-PDIYAAGDICTACWQPSPVWQQMRLWTQARQMGYyaakcMAA 322
Cdd:COG0446  230 IIGPGERPNVVLANDALPGLALAGGAVLVDERGGTSKdPDVYAAGDVAEIPAAETGKGGRIALWAIAVAAGR-----IAA 304
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568944200 323 ASMGHPIDMDFSFELFahVTKFFNYKVVLLGKYNAQGLGADHELMLRCtrGQEYVKVVMQNGRMMGAVLIGETD 396
Cdd:COG0446  305 ENIAGALRIPGLLGTV--ISDVGDLCAASTGLTEGKERGIDVVLVVSG--GKDPRAHLYPGAELVGIKLVGDAD 374
NirB COG1251
NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];
230-424 6.69e-13

NAD(P)H-nitrite reductase, large subunit [Energy production and conversion];


Pssm-ID: 224171 [Multi-domain]  Cd Length: 793  Bit Score: 70.42  E-value: 6.69e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 230 VELTNGTIYGCDFLVSATGVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGDiCTAcwqpspvWQQM 303
Cdd:COG1251  222 VRFADGTEIPADLVVMAVGIRPND---------ELAKEAGLAvnrgivVNDYMQTSDPDIYAVGE-CAE-------HRGK 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 304 R------LWTQARqmgyyaakcMAAASMghpidMDFSFELFAHVTKFFNYKVV---LLGKYNAQGLGADHELMLRCTRGQ 374
Cdd:COG1251  285 VyglvapLYEQAK---------VLADHL-----CGGEAEAYEGSVTSTKLKVSgvdVFSAGDFQETEGAESIVFRDEQRG 350
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 568944200 375 EYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPNID 424
Cdd:COG1251  351 IYKKLVLKDDKIVGAVLYGDTSDGGWLLDLILKGADISEIRDTLILPQGS 400
PRK04965 PRK04965
NADH:flavorubredoxin reductase NorW;
16-288 9.55e-09

NADH:flavorubredoxin reductase NorW;


Pssm-ID: 179902 [Multi-domain]  Cd Length: 377  Bit Score: 56.85  E-value: 9.55e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  16 VKQLKSEDHCIFTeDGREFVYKKLCLCAGAK---PKLiyEGNPRVLGIrdtDSAQEF---QKELAKARRIMIVGNGGIAL 89
Cdd:PRK04965  81 VTDIDAEAQVVKS-QGNQWQYDKLVLATGASafvPPI--PGRELMLTL---NSQQEYraaETQLRDAQRVLVVGGGLIGT 154
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  90 ELAYEI--EGCEVVwaIKDNAigntffdagaaEFLTSKLMSEKSEAKIAHKRTiytveeakketrtkskadyvgsalgpd 167
Cdd:PRK04965 155 ELAMDLcrAGKAVT--LVDNA-----------ASLLASLMPPEVSSRLQHRLT--------------------------- 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 168 whgglalkgteefSHSVHIETRCEVKKIyleeefkimkkkslafpkdhhkSVTADKemwpVYVELTNGTIYGCDFLVSAT 247
Cdd:PRK04965 195 -------------EMGVHLLLKSQLQGL----------------------EKTDSG----IRATLDSGRSIEVDAVIAAA 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 568944200 248 GVTPNVhpflhrnnfALGEDGGLR------VDDQMRTSLPDIYAAGD 288
Cdd:PRK04965 236 GLRPNT---------ALARRAGLAvnrgivVDSYLQTSAPDIYALGD 273
PRK13748 PRK13748
putative mercuric reductase; Provisional
240-300 1.99e-08

putative mercuric reductase; Provisional


Pssm-ID: 184298 [Multi-domain]  Cd Length: 561  Bit Score: 56.31  E-value: 1.99e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568944200 240 CDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTAcwQPSPVW 300
Cdd:PRK13748 354 ADKLLVATGRAPNTRSLaLDAAGVTVNAQGAIVIDQGMRTSVPHIYAAGD-CTD--QPQFVY 412
Lpd COG1249
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component ...
228-394 4.32e-08

Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component or related enzyme [Energy production and conversion];


Pssm-ID: 224169 [Multi-domain]  Cd Length: 454  Bit Score: 54.91  E-value: 4.32e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 228 VYVELTNG--TIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICTacwqpspvwqQMR 304
Cdd:COG1249  247 VLVTLEDGegGTIEADAVLVAIGRKPNTDGLgLENAGVELDDRGFIKVDDQMTTNVPGIYAIGDVIG----------GPM 316
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 305 LWTQARQMGYYAAKCMAAASMgHPIDMD------FSFELFAHV--------TKFFNYKVvllGKYNAQGLGAdhELMLRC 370
Cdd:COG1249  317 LAHVAMAEGRIAAENIAGGKR-TPIDYRlipsvvFTDPEIASVglteeeakEAGIDYKV---GKFPFAANGR--AITMGE 390
                        170       180
                 ....*....|....*....|....*.
gi 568944200 371 TRGqeYVKVVM--QNGRMMGAVLIGE 394
Cdd:COG1249  391 TDG--FVKLVVdkETGRILGAHIVGP 414
PRK09754 PRK09754
phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional
16-191 5.98e-08

phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional


Pssm-ID: 170080 [Multi-domain]  Cd Length: 396  Bit Score: 54.55  E-value: 5.98e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  16 VKQLKSEDHCIFTEDGREFVYKKLCLCAGAKPK---LIYEGNPRVLGIRDTDSAQEFQKELAKARRIMIVGNGGIALELA 92
Cdd:PRK09754  81 IKTLGRDTRELVLTNGESWHWDQLFIATGAAARplpLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  93 YEI--EGCEV-VWAIKDNAIG------------NTFFDAGAAEFLTSKLMSEKSEAKIahkrtiytveEAKKETRTKSKA 157
Cdd:PRK09754 161 ASAtqRRCKVtVIELAATVMGrnapppvqryllQRHQQAGVRILLNNAIEHVVDGEKV----------ELTLQSGETLQA 230
                        170       180       190
                 ....*....|....*....|....*....|....
gi 568944200 158 DYVGSALGPDWHGGLALKGTEEFSHSVHIETRCE 191
Cdd:PRK09754 231 DVVIYGIGISANDQLAREANLDTANGIVIDEACR 264
PRK06370 PRK06370
FAD-containing oxidoreductase;
240-290 4.30e-07

FAD-containing oxidoreductase;


Pssm-ID: 235787 [Multi-domain]  Cd Length: 463  Bit Score: 51.74  E-value: 4.30e-07
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 568944200 240 CDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDIC 290
Cdd:PRK06370 260 GSHILVAVGRVPNTDDLgLEAAGVETDARGYIKVDDQLRTTNPGIYAAGDCN 311
Ndh COG1252
NADH dehydrogenase, FAD-containing subunit [Energy production and conversion];
4-373 9.72e-07

NADH dehydrogenase, FAD-containing subunit [Energy production and conversion];


Pssm-ID: 224172 [Multi-domain]  Cd Length: 405  Bit Score: 50.71  E-value: 9.72e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200   4 SRFPNIKVIESGVKQLKSEDHCIFTEDGREFVYKKLCLCAGAKPKliYEGNPRV----LGIRDTDSAQEF---------- 69
Cdd:COG1252   68 RKSGNVQFVQGEVTDIDRDAKKVTLADLGEISYDYLVVALGSETN--YFGIPGAaeyaFGLKTLEDALRLrrhlleafek 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  70 --QKELAKARR-IMIVGNG--GIalELAYEIegcevvwaikdnaigntffdAGAAEFLTSKLMSEKSEAKIahkrtiyTV 144
Cdd:COG1252  146 asQEEDDRALLtIVIVGGGptGV--ELAGEL--------------------AERLHRLLKKFRVDPSELRV-------IL 196
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 145 EEAkketrtkskADYVGSALGPDwhggLALKGTEEF-SHSVHIETRCEVKKIylEEEFkimkkkslafpkdhhksvtadk 223
Cdd:COG1252  197 VEA---------GPRILPMFPPK----LSKYAERALeKLGVEVLLGTPVTEV--TPDG---------------------- 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 224 emwpVYVELTNGTIyGCDFLVSATGVTPNvhPFLhRN--NFALGEDGGLRVDDQMR-TSLPDIYAAGDiCTACWQPSPVW 300
Cdd:COG1252  240 ----VTLKDGEEEI-PADTVVWAAGVRAS--PLL-KDlsGLETDRRGRLVVNPTLQvPGHPDIFAAGD-CAAVIDPRPVP 310
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568944200 301 Q--QMrlwtqARQMGYYAAKCMAAASMGHPIDMdfsFELFAHVTkffnykVVLLGKYNAQGLgadheLMLRCTRG 373
Cdd:COG1252  311 PtaQA-----AHQQGEYAAKNIKARLKGKPLKP---FKYKDKGT------LASLGDFSAVAD-----LGGVKLKG 366
TrxB COG0492
Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones];
240-325 2.02e-06

Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223566 [Multi-domain]  Cd Length: 305  Bit Score: 49.21  E-value: 2.02e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 240 CDFLVSATGVTPNVHPFLHRNNfaLGEDGGLRVDDQMRTSLPDIYAAGDICTACWqpspvwqqmRLWTQARQMGyyaakC 319
Cdd:COG0492  227 VDGVFIAIGHLPNTELLKGLGV--LDENGYIVVDEEMETSVPGIFAAGDVADKNG---------RQIATAAGDG-----A 290

                 ....*.
gi 568944200 320 MAAASM 325
Cdd:COG0492  291 IAALSA 296
PRK14989 PRK14989
nitrite reductase subunit NirD; Provisional
234-421 2.42e-06

nitrite reductase subunit NirD; Provisional


Pssm-ID: 184951 [Multi-domain]  Cd Length: 847  Bit Score: 49.73  E-value: 2.42e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 234 NGTIYGCDFLVSATGVTPNvHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTAcwqpspvWQQMRLWTQARqmG 313
Cdd:PRK14989 228 DGSELEVDFIVFSTGIRPQ-DKLATQCGLAVAPRGGIVINDSCQTSDPDIYAIGE-CAS-------WNNRVFGLVAP--G 296
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 314 YYaakcMAAASMGHPIDMDFSFE---LFAHVtKFFNYKVVLLGKYNAQGLGADHELMLrcTRGQEYVK---VVMQNGRMM 387
Cdd:PRK14989 297 YK----MAQVAVDHLLGSENAFEgadLSAKL-KLLGVDVGGIGDAHGRTPGARSYVYL--DESKEIYKrliVSEDNKTLL 369
                        170       180       190
                 ....*....|....*....|....*....|....
gi 568944200 388 GAVLIGETDLEETFENLILNQMDLSSYGEDLLDP 421
Cdd:PRK14989 370 GAVLVGDTSDYGNLLQLVLNAIELPENPDSLILP 403
PRK07818 PRK07818
dihydrolipoamide dehydrogenase; Reviewed
241-408 2.46e-06

dihydrolipoamide dehydrogenase; Reviewed


Pssm-ID: 236106 [Multi-domain]  Cd Length: 466  Bit Score: 49.64  E-value: 2.46e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 241 DFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDIcTAcwqpspvwqQMRLWTQARQMGYYAAKC 319
Cdd:PRK07818 263 DKVLQAIGFAPRVEGYgLEKTGVALTDRGAIAIDDYMRTNVPHIYAIGDV-TA---------KLQLAHVAEAQGVVAAET 332
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 320 MAAASMGHPIDMDF------------SFELFAHVTKFFNYKVVLL-------GKynAQGLGAdhelmlrcTRGqeYVKVV 380
Cdd:PRK07818 333 IAGAETLELGDYRMmpratfcqpqvaSFGLTEEQAREEGYDVKVAkfpftanGK--AHGLGD--------PTG--FVKLV 400
                        170       180       190
                 ....*....|....*....|....*....|
gi 568944200 381 M--QNGRMMGAVLIGEtDLEETFENLILNQ 408
Cdd:PRK07818 401 AdaKYGELLGGHLIGP-DVSELLPELTLAQ 429
PRK09564 PRK09564
coenzyme A disulfide reductase; Reviewed
228-295 4.23e-06

coenzyme A disulfide reductase; Reviewed


Pssm-ID: 181958 [Multi-domain]  Cd Length: 444  Bit Score: 48.50  E-value: 4.23e-06
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 568944200 228 VYVELTNGTIYGCDFLVSATGVTPNVHpFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCTACWQ 295
Cdd:PRK09564 223 VEGVVTDKGEYEADVVIVATGVKPNTE-FLEDTGLKTLKNGAIIVDEYGETSIENIYAAGD-CATIYN 288
PRK07251 PRK07251
FAD-containing oxidoreductase;
191-289 5.94e-06

FAD-containing oxidoreductase;


Pssm-ID: 180907 [Multi-domain]  Cd Length: 438  Bit Score: 48.21  E-value: 5.94e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 191 EVKKIYLEEEfkimkkkSLAFPKDHHKSVTADKEMWPVYVelTNGTIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGG 269
Cdd:PRK07251 202 ALAKQYMEED-------GITFLLNAHTTEVKNDGDQVLVV--TEDETYRFDALLYATGRKPNTEPLgLENTDIELTERGA 272
                         90       100
                 ....*....|....*....|
gi 568944200 270 LRVDDQMRTSLPDIYAAGDI 289
Cdd:PRK07251 273 IKVDDYCQTSVPGVFAVGDV 292
PRK06116 PRK06116
glutathione reductase; Validated
230-289 1.02e-05

glutathione reductase; Validated


Pssm-ID: 235701 [Multi-domain]  Cd Length: 450  Bit Score: 47.46  E-value: 1.02e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568944200 230 VELTNGTIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDI 289
Cdd:PRK06116 244 LTLEDGETLTVDCLIWAIGREPNTDGLgLENAGVKLNEKGYIIVDEYQNTNVPGIYAVGDV 304
PRK06416 PRK06416
dihydrolipoamide dehydrogenase; Reviewed
241-289 3.59e-05

dihydrolipoamide dehydrogenase; Reviewed


Pssm-ID: 235798 [Multi-domain]  Cd Length: 462  Bit Score: 45.91  E-value: 3.59e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 568944200 241 DFLVSATGVTPNVhpflhrNNFALGE-----DGGL-RVDDQMRTSLPDIYAAGDI 289
Cdd:PRK06416 262 DYVLVAVGRRPNT------ENLGLEElgvktDRGFiEVDEQLRTNVPNIYAIGDI 310
PRK07846 PRK07846
mycothione reductase; Reviewed
228-291 3.92e-05

mycothione reductase; Reviewed


Pssm-ID: 181142 [Multi-domain]  Cd Length: 451  Bit Score: 45.72  E-value: 3.92e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568944200 228 VYVELTNGTIYGCDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICT 291
Cdd:PRK07846 239 VTLRLDDGSTVEADVLLVATGRVPNGDLLdAAAAGVDVDEDGRVVVDEYQRTSAEGVFALGDVSS 303
PRK07845 PRK07845
flavoprotein disulfide reductase; Reviewed
228-291 3.97e-05

flavoprotein disulfide reductase; Reviewed


Pssm-ID: 236112 [Multi-domain]  Cd Length: 466  Bit Score: 45.62  E-value: 3.97e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568944200 228 VYVELTNG-TIYGCDFLVsATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCT 291
Cdd:PRK07845 251 VVVTLTDGrTVEGSHALM-AVGSVPNTAGLgLEEAGVELTPSGHITVDRVSRTSVPGIYAAGD-CT 314
PRK13512 PRK13512
coenzyme A disulfide reductase; Provisional
230-353 4.17e-05

coenzyme A disulfide reductase; Provisional


Pssm-ID: 184103 [Multi-domain]  Cd Length: 438  Bit Score: 45.54  E-value: 4.17e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 230 VELTNGTIYGCDFLVSATGVTPNVHpFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICTACWQPSPVWQQMRL-Wtq 308
Cdd:PRK13512 220 VTFKSGKVEHYDMIIEGVGTHPNSK-FIESSNIKLDDKGFIPVNDKFETNVPNIYAIGDIITSHYRHVDLPASVPLaW-- 296
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 568944200 309 arqmGYYAAKCMAAASMGHPIDMDFSFELFAHVTKFFNYKVVLLG 353
Cdd:PRK13512 297 ----GAHRAASIVAEQIAGNDTIEFKGFLGNNIVKFFDYTFASVG 337
PRK11749 PRK11749
dihydropyrimidine dehydrogenase subunit A; Provisional
240-291 8.22e-05

dihydropyrimidine dehydrogenase subunit A; Provisional


Pssm-ID: 236967 [Multi-domain]  Cd Length: 457  Bit Score: 44.78  E-value: 8.22e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 568944200 240 CDFLVSATGVTPNVHPFLHRNNFALGEDGGLRVDDQ-MRTSLPDIYAAGDICT 291
Cdd:PRK11749 376 ADLVIKAIGQTPNPLILSTTPGLELNRWGTIIADDEtGRTSLPGVFAGGDIVT 428
PRK14694 PRK14694
putative mercuric reductase; Provisional
228-300 8.39e-05

putative mercuric reductase; Provisional


Pssm-ID: 237790 [Multi-domain]  Cd Length: 468  Bit Score: 44.55  E-value: 8.39e-05
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568944200 228 VYVELTNGTIYGCDFLVSATGVTPNVHPFlhrNNFALG---EDGGLRVDDQMRTSLPDIYAAGDiCTAcwQPSPVW 300
Cdd:PRK14694 250 EFILETNAGTLRAEQLLVATGRTPNTENL---NLESIGvetERGAIRIDEHLQTTVSGIYAAGD-CTD--QPQFVY 319
PTZ00318 PTZ00318
NADH dehydrogenase-like protein; Provisional
191-362 1.94e-04

NADH dehydrogenase-like protein; Provisional


Pssm-ID: 185553 [Multi-domain]  Cd Length: 424  Bit Score: 43.22  E-value: 1.94e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 191 EVKKIYLEEEFKI-------MKKKSLAFPKDHHKSV---TADKEMWPVYVELTNGTIYGCDFLVSATGVTPnvHPFLHRN 260
Cdd:PTZ00318 210 ECKVTVLEAGSEVlgsfdqaLRKYGQRRLRRLGVDIrtkTAVKEVLDKEVVLKDGEVIPTGLVVWSTGVGP--GPLTKQL 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 261 NFALGEDGGLRVDDQMRTS-LPDIYAAGDICTACWQPSPVWQQMrlwtqARQMGYYAAKCMAAASMGHPIDMDFSFELFA 339
Cdd:PTZ00318 288 KVDKTSRGRISVDDHLRVKpIPNVFALGDCAANEERPLPTLAQV-----ASQQGVYLAKEFNNELKGKPMSKPFVYRSLG 362
                        170       180
                 ....*....|....*....|....
gi 568944200 340 HVTKFFNYK-VVLLGKYNAQGLGA 362
Cdd:PTZ00318 363 SLAYLGNYSaIVQLGAFDLSGFKA 386
PRK06292 PRK06292
dihydrolipoamide dehydrogenase; Validated
196-289 2.81e-04

dihydrolipoamide dehydrogenase; Validated


Pssm-ID: 235774 [Multi-domain]  Cd Length: 460  Bit Score: 42.86  E-value: 2.81e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 196 YLEEEFKImkkkslaFPKDHHKSVTADKEMWPVYVELTNGTIY-GCDFLVSATGVTPNV-HPFLHRNNFALGEDGGLRVD 273
Cdd:PRK06292 219 ILSKEFKI-------KLGAKVTSVEKSGDEKVEELEKGGKTETiEADYVLVATGRRPNTdGLGLENTGIELDERGRPVVD 291
                         90
                 ....*....|....*.
gi 568944200 274 DQMRTSLPDIYAAGDI 289
Cdd:PRK06292 292 EHTQTSVPGIYAAGDV 307
PRK12778 PRK12778
bifunctional dihydroorotate dehydrogenase B NAD binding subunit/NADPH-dependent glutamate ...
227-291 5.60e-04

bifunctional dihydroorotate dehydrogenase B NAD binding subunit/NADPH-dependent glutamate synthase;


Pssm-ID: 237200 [Multi-domain]  Cd Length: 752  Bit Score: 42.04  E-value: 5.60e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568944200 227 PVYVELTNGTIyGCDFLVSATGVTPNvhPFLHRN--NFALGEDGGLRVDDQMRTSLPDIYAAGDICT 291
Cdd:PRK12778 663 PVAIPGSTFTV-DVDLVIVSVGVSPN--PLVPSSipGLELNRKGTIVVDEEMQSSIPGIYAGGDIVR 726
PRK06467 PRK06467
dihydrolipoamide dehydrogenase; Reviewed
241-289 1.07e-03

dihydrolipoamide dehydrogenase; Reviewed


Pssm-ID: 180579 [Multi-domain]  Cd Length: 471  Bit Score: 41.09  E-value: 1.07e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 568944200 241 DFLVSATGVTPNVHPFL-HRNNFALGEDGGLRVDDQMRTSLPDIYAAGDI 289
Cdd:PRK06467 264 DAVLVAVGRVPNGKLLDaEKAGVEVDERGFIRVDKQCRTNVPHIFAIGDI 313
PRK05249 PRK05249
Si-specific NAD(P)(+) transhydrogenase;
228-289 1.19e-03

Si-specific NAD(P)(+) transhydrogenase;


Pssm-ID: 235373 [Multi-domain]  Cd Length: 461  Bit Score: 40.91  E-value: 1.19e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568944200 228 VYVELTNGTIYGCDFLVSATGVTPNVHPfLHRNNFALGED--GGLRVDDQMRTSLPDIYAAGDI 289
Cdd:PRK05249 249 VIVHLKSGKKIKADCLLYANGRTGNTDG-LNLENAGLEADsrGQLKVNENYQTAVPHIYAVGDV 311
PTZ00058 PTZ00058
glutathione reductase; Provisional
29-290 1.47e-03

glutathione reductase; Provisional


Pssm-ID: 185420 [Multi-domain]  Cd Length: 561  Bit Score: 40.75  E-value: 1.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200  29 EDGREFVYKKLCLCAGAKPKLiyegnPRVLGIRDTDSAQEFQKeLAKARRIMIVGNGGIALELAyeiegcevvwaikdna 108
Cdd:PTZ00058 196 DDGQVIEGKNILIAVGNKPIF-----PDVKGKEFTISSDDFFK-IKEAKRIGIAGSGYIAVELI---------------- 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 109 igNTFFDAGAAEFLTSKlmsekseakiAHKRTIYTVEEAKKETRTKSKADyvgsalgpdwhgglalkgteefshSVHIET 188
Cdd:PTZ00058 254 --NVVNRLGAESYIFAR----------GNRLLRKFDETIINELENDMKKN------------------------NINIIT 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 189 RCEVKKIYLEEEfkimkKKSLAFPKDHHKSVTADkemwpvyveltngtiygcdFLVSATGVTPNVHPFLHRNNFALGEDG 268
Cdd:PTZ00058 298 HANVEEIEKVKE-----KNLTIYLSDGRKYEHFD-------------------YVIYCVGRSPNTEDLNLKALNIKTPKG 353
                        250       260
                 ....*....|....*....|..
gi 568944200 269 GLRVDDQMRTSLPDIYAAGDIC 290
Cdd:PTZ00058 354 YIKVDDNQRTSVKHIYAVGDCC 375
PRK14727 PRK14727
putative mercuric reductase; Provisional
240-291 1.95e-03

putative mercuric reductase; Provisional


Pssm-ID: 237806 [Multi-domain]  Cd Length: 479  Bit Score: 40.31  E-value: 1.95e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 568944200 240 CDFLVSATGVTPNVHPF-LHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDiCT 291
Cdd:PRK14727 272 AEKLLISTGRHANTHDLnLEAVGVTTDTSGAIVVNPAMETSAPDIYAAGD-CS 323
PRK06327 PRK06327
dihydrolipoamide dehydrogenase; Validated
240-289 3.95e-03

dihydrolipoamide dehydrogenase; Validated


Pssm-ID: 235779 [Multi-domain]  Cd Length: 475  Bit Score: 39.14  E-value: 3.95e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 568944200 240 CDFLVSATGVTPNVHPFLHRN-NFALGEDGGLRVDDQMRTSLPDIYAAGDI 289
Cdd:PRK06327 273 VDKLIVSIGRVPNTDGLGLEAvGLKLDERGFIPVDDHCRTNVPNVYAIGDV 323
PRK12770 PRK12770
putative glutamate synthase subunit beta; Provisional
241-322 6.78e-03

putative glutamate synthase subunit beta; Provisional


Pssm-ID: 237197 [Multi-domain]  Cd Length: 352  Bit Score: 38.43  E-value: 6.78e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568944200 241 DFLVSATGVTPNvHPFlhrNNFALG----EDGGLRVDDQMRTSLPDIYAAGDICTAcwqPSPVWQQMRlwtqarqMGYYA 316
Cdd:PRK12770 276 DTVVFAIGEIPT-PPF---AKECLGielnRKGEIVVDEKHMTSREGVFAAGDVVTG---PSKIGKAIK-------SGLRA 341

                 ....*.
gi 568944200 317 AKCMAA 322
Cdd:PRK12770 342 AQSIHE 347
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH