NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907177040|ref|XP_006507361|]
View 

deleted in malignant brain tumors 1 protein isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1728-1975 1.46e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


:

Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.78  E-value: 1.46e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1728 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1803
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1804 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1881
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1882 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1957
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 1907177040  1958 VCRAYDTSSRCYRGCVVR 1975
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
439-539 3.71e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 172.91  E-value: 3.71e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   439 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 518
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   519 SHRGWLSHNCGHHEDAGVICS 539
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
856-956 2.82e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 2.82e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   856 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 935
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   936 SHRGWLSHNCGHHEDAGVICS 956
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1486-1585 2.87e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 2.87e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1486 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1565
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 1907177040  1566 HHPGWLVHNCRHSEDAGVIC 1585
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
578-678 3.13e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 3.13e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   578 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 657
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   658 SHRGWLSHNCGHHEDAGVICS 678
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
152-252 5.83e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.44  E-value: 5.83e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   152 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 231
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   232 SHRGWLSHNCGHQEDAGVICS 252
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
301-401 9.47e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 9.47e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   301 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 380
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   381 SHQGWLSHNCGHQEDAGVICS 401
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
717-817 2.27e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 167.52  E-value: 2.27e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   717 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 796
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   797 SHRGWLSHNCGHHEDAGVICS 817
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
33-133 1.98e-45

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 159.43  E-value: 1.98e-45
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040    33 LRLVNGSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGAHFGEGSGNILLGAVHCSGWESYLSSC 112
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   113 QHDGWYNHDCGHREDAGVVCS 133
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1609-1717 7.38e-38

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 138.31  E-value: 7.38e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1609 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1684
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1685 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1717
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1241-1349 7.83e-35

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.45  E-value: 7.83e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1241 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1316
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1317 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1349
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1115-1223 2.05e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 128.30  E-value: 2.05e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1115 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1190
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1191 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1223
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
999-1107 3.14e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 3.14e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  999 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1074
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1075 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1107
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1357-1465 1.35e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.91  E-value: 1.35e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1357 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1432
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1433 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1465
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1728-1975 1.46e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.78  E-value: 1.46e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1728 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1803
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1804 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1881
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1882 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1957
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 1907177040  1958 VCRAYDTSSRCYRGCVVR 1975
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
Zona_pellucida pfam00100
Zona pellucida-like domain;
1728-1973 1.62e-51

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 182.44  E-value: 1.62e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1728 CQSNHMQASVSRSYLQSMGYsARDLVIPGWNSSyHCQPqiTQREVIFTIPYTGCGTIKQADNETINYSNFLRA--VVSNG 1805
Cdd:pfam00100    1 CTVDTIVSSISQNPTLPSLL-LDEVSLLGGDDA-TCSP--VGATVIFEFPSTACGTVFQVIGTVKIYSNRLYAstDVGWI 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1806 IIKRRKDLNIHVSCKMLQNTWVNTmyitnntveiqEVQYGNFDVNISFYTSSSFLFPVTSSPYYVDLDQNLYLQAEILHS 1885
Cdd:pfam00100   77 TRSITRKLRVYFRASYDSSSAVNV-----------GSGSGVLLMSLDLYKSESYSVYYVPYPVTKLLRQPVYVEVELLSR 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1886 -DASLALFVDTCVASPHPNDFSSLTY-DLIRSGCVRDDTY----------QSYSSPSPRVSRFKFSSFHFLNRF----PS 1949
Cdd:pfam00100  146 tDPNLNLLLDLCWATPSANPTSDIIWwDICVDGCDNTDDSyysprlpvtvTSVNNYPSHYKRFFFFMFTFVDDTdalsGQ 225
                          250       260
                   ....*....|....*....|....
gi 1907177040 1950 VYLQCKLVVCRAydTSSRCYRGCV 1973
Cdd:pfam00100  226 VYLHCSASQCSS--NSNCCADSCR 247
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
439-539 3.71e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 172.91  E-value: 3.71e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   439 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 518
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   519 SHRGWLSHNCGHHEDAGVICS 539
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
856-956 2.82e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 2.82e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   856 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 935
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   936 SHRGWLSHNCGHHEDAGVICS 956
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1486-1585 2.87e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 2.87e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1486 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1565
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 1907177040  1566 HHPGWLVHNCRHSEDAGVIC 1585
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
578-678 3.13e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 3.13e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   578 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 657
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   658 SHRGWLSHNCGHHEDAGVICS 678
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
152-252 5.83e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.44  E-value: 5.83e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   152 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 231
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   232 SHRGWLSHNCGHQEDAGVICS 252
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
301-401 9.47e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 9.47e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   301 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 380
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   381 SHQGWLSHNCGHQEDAGVICS 401
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
717-817 2.27e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 167.52  E-value: 2.27e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   717 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 796
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   797 SHRGWLSHNCGHHEDAGVICS 817
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
33-133 1.98e-45

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 159.43  E-value: 1.98e-45
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040    33 LRLVNGSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGAHFGEGSGNILLGAVHCSGWESYLSSC 112
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   113 QHDGWYNHDCGHREDAGVVCS 133
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
1491-1586 1.45e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 150.97  E-value: 1.45e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1491 GSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAP-GNAWFGQG-SGLIVLDDVSCSGYESHLWNCHHP 1568
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040 1569 GWLVHNCRHSEDAGVICA 1586
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
583-678 2.17e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 147.51  E-value: 2.17e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  583 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 660
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  661 GWLSHNCGHHEDAGVICS 678
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
722-817 2.17e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 147.51  E-value: 2.17e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  722 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 799
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  800 GWLSHNCGHHEDAGVICS 817
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
157-252 5.79e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.35  E-value: 5.79e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  157 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GNARFGQG-SGPIVMDDVACGGYEDYLWRCSHR 234
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  235 GWLSHNCGHQEDAGVICS 252
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
861-956 1.51e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 145.19  E-value: 1.51e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  861 GGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWSCSHR 938
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  939 GWLSHNCGHHEDAGVICS 956
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
444-539 2.15e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 144.81  E-value: 2.15e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  444 GGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWRCSHR 521
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  522 GWLSHNCGHHEDAGVICS 539
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
38-133 8.67e-39

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 140.19  E-value: 8.67e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   38 GSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGA-HFGEG-SGNILLGAVHCSGWESYLSSCQHD 115
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGAsFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  116 GWYNHDCGHREDAGVVCS 133
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
306-401 1.85e-38

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 139.42  E-value: 1.85e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  306 GGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAP-GNAYFGQGQ-GPIVLDDVACGGYENYLWSCSHQ 383
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGStGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  384 GWLSHNCGHQEDAGVICS 401
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1609-1717 7.38e-38

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 138.31  E-value: 7.38e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1609 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1684
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1685 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1717
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB pfam00431
CUB domain;
1609-1715 2.66e-35

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 130.88  E-value: 2.66e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1609 CGGFLTQPSGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCdGSL 1686
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEdhDECGYDYVEIRDGPSASSPLLGRFC-GSG 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 1907177040 1687 GS--FTSTSNFMSIRFITDHSITARGFQAHY 1715
Cdd:pfam00431   80 IPedIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1241-1349 7.83e-35

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.45  E-value: 7.83e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1241 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1316
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1317 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1349
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1115-1223 2.05e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 128.30  E-value: 2.05e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1115 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1190
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1191 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1223
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
999-1107 3.14e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 3.14e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  999 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1074
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1075 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1107
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1618-1715 1.29e-33

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 125.58  E-value: 1.29e-33
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1618 GQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCDGSLGS--FTSTS 1693
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLEssDNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1694 NFMSIRFITDHSITARGFQAHY 1715
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1357-1465 1.35e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.91  E-value: 1.35e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1357 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1432
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1433 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1465
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1250-1347 5.15e-32

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 120.96  E-value: 5.15e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1250 GQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1325
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1326 NFMSVVFITDGSVTRRGFQAHY 1347
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1008-1105 2.55e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 119.03  E-value: 2.55e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1008 GQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1083
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1084 NFMSVVFITDGSVTRRGFQAHY 1105
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1124-1221 3.62e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.65  E-value: 3.62e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1124 GQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVCDGSNGS--FTSTG 1199
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1200 NFMSVVFITDGSVTRRGFQAHY 1221
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
1241-1347 1.45e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 117.01  E-value: 1.45e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1241 CGGLLTLPSGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1317
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1318 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1347
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1357-1463 6.24e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.47  E-value: 6.24e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1357 CGGLLTQPSGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVC-DGF 1433
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1434 NGSFTSTGNFMSVVFITDGSVTRRGFQAYY 1463
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
999-1105 6.94e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 6.94e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  999 CGGLLTQPSGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1075
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1076 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1105
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1115-1221 1.33e-29

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 114.31  E-value: 1.33e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1115 CGGLLTQPSGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVC-DGS 1191
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1192 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1221
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1366-1463 1.34e-29

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 114.02  E-value: 1.34e-29
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1366 GQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVCDGFNGS--FTSTG 1441
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1442 NFMSVVFITDGSVTRRGFQAYY 1463
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1728-1975 1.46e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.78  E-value: 1.46e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1728 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1803
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1804 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1881
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1882 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1957
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 1907177040  1958 VCRAYDTSSRCYRGCVVR 1975
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
Zona_pellucida pfam00100
Zona pellucida-like domain;
1728-1973 1.62e-51

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 182.44  E-value: 1.62e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1728 CQSNHMQASVSRSYLQSMGYsARDLVIPGWNSSyHCQPqiTQREVIFTIPYTGCGTIKQADNETINYSNFLRA--VVSNG 1805
Cdd:pfam00100    1 CTVDTIVSSISQNPTLPSLL-LDEVSLLGGDDA-TCSP--VGATVIFEFPSTACGTVFQVIGTVKIYSNRLYAstDVGWI 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1806 IIKRRKDLNIHVSCKMLQNTWVNTmyitnntveiqEVQYGNFDVNISFYTSSSFLFPVTSSPYYVDLDQNLYLQAEILHS 1885
Cdd:pfam00100   77 TRSITRKLRVYFRASYDSSSAVNV-----------GSGSGVLLMSLDLYKSESYSVYYVPYPVTKLLRQPVYVEVELLSR 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1886 -DASLALFVDTCVASPHPNDFSSLTY-DLIRSGCVRDDTY----------QSYSSPSPRVSRFKFSSFHFLNRF----PS 1949
Cdd:pfam00100  146 tDPNLNLLLDLCWATPSANPTSDIIWwDICVDGCDNTDDSyysprlpvtvTSVNNYPSHYKRFFFFMFTFVDDTdalsGQ 225
                          250       260
                   ....*....|....*....|....
gi 1907177040 1950 VYLQCKLVVCRAydTSSRCYRGCV 1973
Cdd:pfam00100  226 VYLHCSASQCSS--NSNCCADSCR 247
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
439-539 3.71e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 172.91  E-value: 3.71e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   439 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 518
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   519 SHRGWLSHNCGHHEDAGVICS 539
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
856-956 2.82e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 2.82e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   856 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 935
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   936 SHRGWLSHNCGHHEDAGVICS 956
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1486-1585 2.87e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 2.87e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1486 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1565
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 1907177040  1566 HHPGWLVHNCRHSEDAGVIC 1585
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
578-678 3.13e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 170.22  E-value: 3.13e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   578 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 657
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   658 SHRGWLSHNCGHHEDAGVICS 678
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
152-252 5.83e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.44  E-value: 5.83e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   152 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 231
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   232 SHRGWLSHNCGHQEDAGVICS 252
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
301-401 9.47e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 9.47e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   301 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 380
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   381 SHQGWLSHNCGHQEDAGVICS 401
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
717-817 2.27e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 167.52  E-value: 2.27e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   717 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 796
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   797 SHRGWLSHNCGHHEDAGVICS 817
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
33-133 1.98e-45

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 159.43  E-value: 1.98e-45
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040    33 LRLVNGSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGAHFGEGSGNILLGAVHCSGWESYLSSC 112
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177040   113 QHDGWYNHDCGHREDAGVVCS 133
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
1491-1586 1.45e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 150.97  E-value: 1.45e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1491 GSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAP-GNAWFGQG-SGLIVLDDVSCSGYESHLWNCHHP 1568
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040 1569 GWLVHNCRHSEDAGVICA 1586
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
583-678 2.17e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 147.51  E-value: 2.17e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  583 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 660
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  661 GWLSHNCGHHEDAGVICS 678
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
722-817 2.17e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 147.51  E-value: 2.17e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  722 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 799
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  800 GWLSHNCGHHEDAGVICS 817
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
157-252 5.79e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.35  E-value: 5.79e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  157 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GNARFGQG-SGPIVMDDVACGGYEDYLWRCSHR 234
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  235 GWLSHNCGHQEDAGVICS 252
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
861-956 1.51e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 145.19  E-value: 1.51e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  861 GGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWSCSHR 938
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  939 GWLSHNCGHHEDAGVICS 956
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
444-539 2.15e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 144.81  E-value: 2.15e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  444 GGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWRCSHR 521
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  522 GWLSHNCGHHEDAGVICS 539
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
38-133 8.67e-39

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 140.19  E-value: 8.67e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040   38 GSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGA-HFGEG-SGNILLGAVHCSGWESYLSSCQHD 115
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGAsFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  116 GWYNHDCGHREDAGVVCS 133
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
306-401 1.85e-38

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 139.42  E-value: 1.85e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  306 GGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAP-GNAYFGQGQ-GPIVLDDVACGGYENYLWSCSHQ 383
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGStGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177040  384 GWLSHNCGHQEDAGVICS 401
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1609-1717 7.38e-38

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 138.31  E-value: 7.38e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1609 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1684
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1685 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1717
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB pfam00431
CUB domain;
1609-1715 2.66e-35

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 130.88  E-value: 2.66e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1609 CGGFLTQPSGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCdGSL 1686
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEdhDECGYDYVEIRDGPSASSPLLGRFC-GSG 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 1907177040 1687 GS--FTSTSNFMSIRFITDHSITARGFQAHY 1715
Cdd:pfam00431   80 IPedIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1241-1349 7.83e-35

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.45  E-value: 7.83e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1241 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1316
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1317 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1349
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1115-1223 2.05e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 128.30  E-value: 2.05e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1115 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1190
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1191 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1223
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
999-1107 3.14e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 3.14e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  999 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1074
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1075 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1107
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1618-1715 1.29e-33

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 125.58  E-value: 1.29e-33
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1618 GQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCDGSLGS--FTSTS 1693
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLEssDNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1694 NFMSIRFITDHSITARGFQAHY 1715
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1357-1465 1.35e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.91  E-value: 1.35e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1357 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1432
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177040 1433 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1465
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1250-1347 5.15e-32

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 120.96  E-value: 5.15e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1250 GQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1325
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1326 NFMSVVFITDGSVTRRGFQAHY 1347
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1008-1105 2.55e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 119.03  E-value: 2.55e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1008 GQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1083
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1084 NFMSVVFITDGSVTRRGFQAHY 1105
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1124-1221 3.62e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.65  E-value: 3.62e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1124 GQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVCDGSNGS--FTSTG 1199
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1200 NFMSVVFITDGSVTRRGFQAHY 1221
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
1241-1347 1.45e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 117.01  E-value: 1.45e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1241 CGGLLTLPSGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1317
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1318 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1347
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1357-1463 6.24e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.47  E-value: 6.24e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1357 CGGLLTQPSGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVC-DGF 1433
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1434 NGSFTSTGNFMSVVFITDGSVTRRGFQAYY 1463
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
999-1105 6.94e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 6.94e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  999 CGGLLTQPSGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1075
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1076 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1105
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1115-1221 1.33e-29

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 114.31  E-value: 1.33e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040 1115 CGGLLTQPSGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVC-DGS 1191
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177040 1192 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1221
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1366-1463 1.34e-29

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 114.02  E-value: 1.34e-29
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177040  1366 GQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVCDGFNGS--FTSTG 1441
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177040  1442 NFMSVVFITDGSVTRRGFQAYY 1463
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH