NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907177051|ref|XP_006507365|]
View 

deleted in malignant brain tumors 1 protein isoform X5 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1728-1975 2.48e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


:

Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.01  E-value: 2.48e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1728 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1803
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1804 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1881
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1882 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1957
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 1907177051  1958 VCRAYDTSSRCYRGCVVR 1975
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
439-539 5.96e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 172.14  E-value: 5.96e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   439 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 518
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   519 SHRGWLSHNCGHHEDAGVICS 539
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
856-956 4.48e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 4.48e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   856 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 935
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   936 SHRGWLSHNCGHHEDAGVICS 956
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1486-1585 4.53e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 4.53e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1486 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1565
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 1907177051  1566 HHPGWLVHNCRHSEDAGVIC 1585
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
578-678 4.99e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.44  E-value: 4.99e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   578 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 657
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   658 SHRGWLSHNCGHHEDAGVICS 678
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
152-252 9.19e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 9.19e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   152 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 231
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   232 SHRGWLSHNCGHQEDAGVICS 252
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
301-401 1.49e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.29  E-value: 1.49e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   301 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 380
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   381 SHQGWLSHNCGHQEDAGVICS 401
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
717-817 3.57e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 167.13  E-value: 3.57e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   717 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 796
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   797 SHRGWLSHNCGHHEDAGVICS 817
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
33-133 2.97e-45

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


:

Pssm-ID: 214555  Cd Length: 101  Bit Score: 158.66  E-value: 2.97e-45
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051    33 LRLVNGSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGAHFGEGSGNILLGAVHCSGWESYLSSC 112
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   113 QHDGWYNHDCGHREDAGVVCS 133
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1609-1717 1.13e-37

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 137.54  E-value: 1.13e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1609 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1684
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1685 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1717
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1241-1349 1.16e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.07  E-value: 1.16e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1241 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1316
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1317 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1349
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1115-1223 3.04e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 3.04e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1115 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1190
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1191 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1223
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
999-1107 4.71e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.14  E-value: 4.71e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  999 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1074
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1075 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1107
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1357-1465 2.03e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.52  E-value: 2.03e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1357 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1432
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1433 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1465
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1728-1975 2.48e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.01  E-value: 2.48e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1728 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1803
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1804 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1881
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1882 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1957
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 1907177051  1958 VCRAYDTSSRCYRGCVVR 1975
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
Zona_pellucida pfam00100
Zona pellucida-like domain;
1728-1973 2.77e-51

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 181.67  E-value: 2.77e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1728 CQSNHMQASVSRSYLQSMGYsARDLVIPGWNSSyHCQPqiTQREVIFTIPYTGCGTIKQADNETINYSNFLRA--VVSNG 1805
Cdd:pfam00100    1 CTVDTIVSSISQNPTLPSLL-LDEVSLLGGDDA-TCSP--VGATVIFEFPSTACGTVFQVIGTVKIYSNRLYAstDVGWI 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1806 IIKRRKDLNIHVSCKMLQNTWVNTmyitnntveiqEVQYGNFDVNISFYTSSSFLFPVTSSPYYVDLDQNLYLQAEILHS 1885
Cdd:pfam00100   77 TRSITRKLRVYFRASYDSSSAVNV-----------GSGSGVLLMSLDLYKSESYSVYYVPYPVTKLLRQPVYVEVELLSR 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1886 -DASLALFVDTCVASPHPNDFSSLTY-DLIRSGCVRDDTY----------QSYSSPSPRVSRFKFSSFHFLNRF----PS 1949
Cdd:pfam00100  146 tDPNLNLLLDLCWATPSANPTSDIIWwDICVDGCDNTDDSyysprlpvtvTSVNNYPSHYKRFFFFMFTFVDDTdalsGQ 225
                          250       260
                   ....*....|....*....|....
gi 1907177051 1950 VYLQCKLVVCRAydTSSRCYRGCV 1973
Cdd:pfam00100  226 VYLHCSASQCSS--NSNCCADSCR 247
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
439-539 5.96e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 172.14  E-value: 5.96e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   439 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 518
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   519 SHRGWLSHNCGHHEDAGVICS 539
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
856-956 4.48e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 4.48e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   856 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 935
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   936 SHRGWLSHNCGHHEDAGVICS 956
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1486-1585 4.53e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 4.53e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1486 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1565
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 1907177051  1566 HHPGWLVHNCRHSEDAGVIC 1585
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
578-678 4.99e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.44  E-value: 4.99e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   578 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 657
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   658 SHRGWLSHNCGHHEDAGVICS 678
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
152-252 9.19e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 9.19e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   152 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 231
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   232 SHRGWLSHNCGHQEDAGVICS 252
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
301-401 1.49e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.29  E-value: 1.49e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   301 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 380
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   381 SHQGWLSHNCGHQEDAGVICS 401
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
717-817 3.57e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 167.13  E-value: 3.57e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   717 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 796
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   797 SHRGWLSHNCGHHEDAGVICS 817
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
33-133 2.97e-45

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 158.66  E-value: 2.97e-45
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051    33 LRLVNGSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGAHFGEGSGNILLGAVHCSGWESYLSSC 112
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   113 QHDGWYNHDCGHREDAGVVCS 133
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
1491-1586 2.52e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 150.20  E-value: 2.52e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1491 GSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAP-GNAWFGQG-SGLIVLDDVSCSGYESHLWNCHHP 1568
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051 1569 GWLVHNCRHSEDAGVICA 1586
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
583-678 3.78e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.74  E-value: 3.78e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  583 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 660
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  661 GWLSHNCGHHEDAGVICS 678
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
722-817 3.78e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.74  E-value: 3.78e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  722 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 799
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  800 GWLSHNCGHHEDAGVICS 817
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
157-252 1.01e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 145.58  E-value: 1.01e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  157 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GNARFGQG-SGPIVMDDVACGGYEDYLWRCSHR 234
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  235 GWLSHNCGHQEDAGVICS 252
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
861-956 2.53e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 144.42  E-value: 2.53e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  861 GGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWSCSHR 938
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  939 GWLSHNCGHHEDAGVICS 956
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
444-539 3.59e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 144.04  E-value: 3.59e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  444 GGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWRCSHR 521
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  522 GWLSHNCGHHEDAGVICS 539
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
38-133 1.43e-38

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 139.42  E-value: 1.43e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   38 GSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGA-HFGEG-SGNILLGAVHCSGWESYLSSCQHD 115
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGAsFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  116 GWYNHDCGHREDAGVVCS 133
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
306-401 3.00e-38

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 138.65  E-value: 3.00e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  306 GGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAP-GNAYFGQGQ-GPIVLDDVACGGYENYLWSCSHQ 383
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGStGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  384 GWLSHNCGHQEDAGVICS 401
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1609-1717 1.13e-37

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 137.54  E-value: 1.13e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1609 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1684
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1685 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1717
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB pfam00431
CUB domain;
1609-1715 3.88e-35

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 130.11  E-value: 3.88e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1609 CGGFLTQPSGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCdGSL 1686
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEdhDECGYDYVEIRDGPSASSPLLGRFC-GSG 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 1907177051 1687 GS--FTSTSNFMSIRFITDHSITARGFQAHY 1715
Cdd:pfam00431   80 IPedIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1241-1349 1.16e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.07  E-value: 1.16e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1241 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1316
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1317 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1349
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1115-1223 3.04e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 3.04e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1115 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1190
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1191 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1223
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
999-1107 4.71e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.14  E-value: 4.71e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  999 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1074
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1075 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1107
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1618-1715 1.80e-33

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 125.20  E-value: 1.80e-33
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1618 GQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCDGSLGS--FTSTS 1693
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLEssDNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1694 NFMSIRFITDHSITARGFQAHY 1715
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1357-1465 2.03e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.52  E-value: 2.03e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1357 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1432
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1433 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1465
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1250-1347 7.43e-32

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 120.57  E-value: 7.43e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1250 GQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1325
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1326 NFMSVVFITDGSVTRRGFQAHY 1347
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1008-1105 3.73e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.65  E-value: 3.73e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1008 GQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1083
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1084 NFMSVVFITDGSVTRRGFQAHY 1105
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1124-1221 5.23e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.26  E-value: 5.23e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1124 GQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVCDGSNGS--FTSTG 1199
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1200 NFMSVVFITDGSVTRRGFQAHY 1221
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
1241-1347 2.02e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 116.63  E-value: 2.02e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1241 CGGLLTLPSGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1317
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1318 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1347
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1357-1463 8.50e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 8.50e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1357 CGGLLTQPSGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVC-DGF 1433
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1434 NGSFTSTGNFMSVVFITDGSVTRRGFQAYY 1463
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
999-1105 9.74e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 114.70  E-value: 9.74e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  999 CGGLLTQPSGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1075
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1076 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1105
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1115-1221 1.87e-29

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 113.93  E-value: 1.87e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1115 CGGLLTQPSGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVC-DGS 1191
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1192 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1221
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1366-1463 1.90e-29

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 113.64  E-value: 1.90e-29
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1366 GQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVCDGFNGS--FTSTG 1441
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1442 NFMSVVFITDGSVTRRGFQAYY 1463
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
 
Name Accession Description Interval E-value
ZP smart00241
Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona ...
1728-1975 2.48e-60

Zona pellucida (ZP) domain; ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).


Pssm-ID: 214579  Cd Length: 252  Bit Score: 208.01  E-value: 2.48e-60
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1728 CQSNHMQASVSRSYLQSMGYSARDLVIPGwnssYHCQPQI---TQREVIFTIPYTGCGTIKQADNETINYSNFLR-AVVS 1803
Cdd:smart00241    2 CGEDQMVVSVSTDLLFPGGINVKGLTLGD----PSCRPQFtdaTSAFVSFEVPLNGCGTRRQVNPDGIVYSNTLVvSPFH 77
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1804 NGIIKRRKDLNIHVSCKMLQNTWVNTMYITNN--TVEIQEVQYGNFDVNISFYTSSSFLFPVTSSPYYvdLDQNLYLQAE 1881
Cdd:smart00241   78 PGFITRDDRAAYHFQCFYPENEKVSLNLDVSTipPTELSSVSEGPLTCSYRLYKDDSFGSPYQSADYV--LGDPVYHEWE 155
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1882 ILHS-DASLALFVDTCVASPHPNDFSSLTYDLIRSGCVRD---DTYQSYSSPSPRVSRFKFSSFHFLNRfPSVYLQCKLV 1957
Cdd:smart00241  156 CDGAdDPPLGLLVDNCYATPGPDPSSGPKYFIIDNGCPVDgylDSTIPYNSNPLHRARFSVKVFKFADR-SLVYFHCQIR 234
                           250
                    ....*....|....*...
gi 1907177051  1958 VCRAYDTSSRCYRGCVVR 1975
Cdd:smart00241  235 LCDKDDGSSCDGPACSSR 252
Zona_pellucida pfam00100
Zona pellucida-like domain;
1728-1973 2.77e-51

Zona pellucida-like domain;


Pssm-ID: 395051  Cd Length: 247  Bit Score: 181.67  E-value: 2.77e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1728 CQSNHMQASVSRSYLQSMGYsARDLVIPGWNSSyHCQPqiTQREVIFTIPYTGCGTIKQADNETINYSNFLRA--VVSNG 1805
Cdd:pfam00100    1 CTVDTIVSSISQNPTLPSLL-LDEVSLLGGDDA-TCSP--VGATVIFEFPSTACGTVFQVIGTVKIYSNRLYAstDVGWI 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1806 IIKRRKDLNIHVSCKMLQNTWVNTmyitnntveiqEVQYGNFDVNISFYTSSSFLFPVTSSPYYVDLDQNLYLQAEILHS 1885
Cdd:pfam00100   77 TRSITRKLRVYFRASYDSSSAVNV-----------GSGSGVLLMSLDLYKSESYSVYYVPYPVTKLLRQPVYVEVELLSR 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1886 -DASLALFVDTCVASPHPNDFSSLTY-DLIRSGCVRDDTY----------QSYSSPSPRVSRFKFSSFHFLNRF----PS 1949
Cdd:pfam00100  146 tDPNLNLLLDLCWATPSANPTSDIIWwDICVDGCDNTDDSyysprlpvtvTSVNNYPSHYKRFFFFMFTFVDDTdalsGQ 225
                          250       260
                   ....*....|....*....|....
gi 1907177051 1950 VYLQCKLVVCRAydTSSRCYRGCV 1973
Cdd:pfam00100  226 VYLHCSASQCSS--NSNCCADSCR 247
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
439-539 5.96e-50

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 172.14  E-value: 5.96e-50
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   439 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRC 518
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   519 SHRGWLSHNCGHHEDAGVICS 539
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
856-956 4.48e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 4.48e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   856 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWSC 935
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   936 SHRGWLSHNCGHHEDAGVICS 956
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
1486-1585 4.53e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.83  E-value: 4.53e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1486 LRLVNGSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAPGNAWFGQGSGLIVLDDVSCSGYESHLWNC 1565
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|
gi 1907177051  1566 HHPGWLVHNCRHSEDAGVIC 1585
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVC 100
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
578-678 4.99e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 169.44  E-value: 4.99e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   578 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 657
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   658 SHRGWLSHNCGHHEDAGVICS 678
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
152-252 9.19e-49

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.67  E-value: 9.19e-49
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   152 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGNARFGQGSGPIVMDDVACGGYEDYLWRC 231
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   232 SHRGWLSHNCGHQEDAGVICS 252
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
301-401 1.49e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 168.29  E-value: 1.49e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   301 VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSC 380
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   381 SHQGWLSHNCGHQEDAGVICS 401
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
717-817 3.57e-48

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 167.13  E-value: 3.57e-48
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   717 VRLENGGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYEDYLWRC 796
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   797 SHRGWLSHNCGHHEDAGVICS 817
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SR smart00202
Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR ...
33-133 2.97e-45

Scavenger receptor Cys-rich; The sea urchin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.


Pssm-ID: 214555  Cd Length: 101  Bit Score: 158.66  E-value: 2.97e-45
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051    33 LRLVNGSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGAHFGEGSGNILLGAVHCSGWESYLSSC 112
Cdd:smart00202    1 VRLVGGGSPCEGRVEVYHNGQWGTVCDDGWDLRDANVVCRQLGFGGAVSASGSAYFGPGSGPIWLDNVRCSGTEASLSDC 80
                            90       100
                    ....*....|....*....|.
gi 1907177051   113 QHDGWYNHDCGHREDAGVVCS 133
Cdd:smart00202   81 PHSGWGSHNCSHGEDAGVVCS 101
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
1491-1586 2.52e-42

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 150.20  E-value: 2.52e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1491 GSNRCEGRVEILYRGSWGTVCDDSWGISDANVVCRQLGCGSALSAP-GNAWFGQG-SGLIVLDDVSCSGYESHLWNCHHP 1568
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051 1569 GWLVHNCRHSEDAGVICA 1586
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
583-678 3.78e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.74  E-value: 3.78e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  583 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 660
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  661 GWLSHNCGHHEDAGVICS 678
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
722-817 3.78e-41

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 146.74  E-value: 3.78e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  722 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GSARFGQG-TGPIVMDDVACGGYEDYLWRCSHR 799
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  800 GWLSHNCGHHEDAGVICS 817
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
157-252 1.01e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 145.58  E-value: 1.01e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  157 GGDRCQGRVEILYQGSWGTVCDDSWDLNDANVVCRQLGCGLAVSAP-GNARFGQG-SGPIVMDDVACGGYEDYLWRCSHR 234
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  235 GWLSHNCGHQEDAGVICS 252
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
861-956 2.53e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 144.42  E-value: 2.53e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  861 GGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWSCSHR 938
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  939 GWLSHNCGHHEDAGVICS 956
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
444-539 3.59e-40

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 144.04  E-value: 3.59e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  444 GGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYF--GPGSGSIVLDDVACTGHEDYLWRCSHR 521
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGASFfgPGSTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  522 GWLSHNCGHHEDAGVICS 539
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
38-133 1.43e-38

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 139.42  E-value: 1.43e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051   38 GSDRCQGRVEVLYQGSWGTVCDDSWDTQDADVVCQQLGCGHSVSAPGGA-HFGEG-SGNILLGAVHCSGWESYLSSCQHD 115
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASSGAsFFGPGsTGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  116 GWYNHDCGHREDAGVVCS 133
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
SRCR pfam00530
Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular ...
306-401 3.00e-38

Scavenger receptor cysteine-rich domain; These domains are disulphide rich extracellular domains. These domains are found in several extracellular receptors and may be involved in protein-protein interactions.


Pssm-ID: 395421  Cd Length: 98  Bit Score: 138.65  E-value: 3.00e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  306 GGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAP-GNAYFGQGQ-GPIVLDDVACGGYENYLWSCSHQ 383
Cdd:pfam00530    1 GSSPCEGRVEVRYNGSWGTVCDDGWDLRDANVVCRQLGCGGAVQASsGASFFGPGStGPIWLDDVRCSGNETSLWQCPHR 80
                           90
                   ....*....|....*...
gi 1907177051  384 GWLSHNCGHQEDAGVICS 401
Cdd:pfam00530   81 PWGNHNCSHSEDAGVICS 98
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1609-1717 1.13e-37

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 137.54  E-value: 1.13e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1609 CGGFLTQP-SGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVC-DG 1684
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1685 SLGSFTSTSNFMSIRFITDHSITARGFQAHYYS 1717
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB pfam00431
CUB domain;
1609-1715 3.88e-35

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 130.11  E-value: 3.88e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1609 CGGFLTQPSGQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCdGSL 1686
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEdhDECGYDYVEIRDGPSASSPLLGRFC-GSG 79
                           90       100       110
                   ....*....|....*....|....*....|.
gi 1907177051 1687 GS--FTSTSNFMSIRFITDHSITARGFQAHY 1715
Cdd:pfam00431   80 IPedIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1241-1349 1.16e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 129.07  E-value: 1.16e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1241 CGGLLTLP-SGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1316
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1317 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1349
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1115-1223 3.04e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.91  E-value: 3.04e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1115 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPQYNSSLIARVC-DG 1190
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1191 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1223
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
999-1107 4.71e-34

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 127.14  E-value: 4.71e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  999 CGGLLTQP-SGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLE--GGCNYDYILVYDGPEYNSSLIARVC-DG 1074
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1075 SNGSFTSTGNFMSVVFITDGSVTRRGFQAHYYS 1107
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1618-1715 1.80e-33

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 125.20  E-value: 1.80e-33
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1618 GQFSSPFYPGNYPNNARCLWNIEVPNNYRVTVVFRDLQLE--RGCSYDYIEIFDGPHHSSPLIARVCDGSLGS--FTSTS 1693
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLEssDNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1694 NFMSIRFITDHSITARGFQAHY 1715
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
1357-1465 2.03e-32

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 122.52  E-value: 2.03e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1357 CGGLLTQP-SGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLE--GGCSFDYILVYDGPEYNSSLIAPVC-DG 1432
Cdd:cd00041      1 CGGTLTAStSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLEssPNCSYDYLEIYDGPSTSSPLLGRFCgST 80
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1907177051 1433 FNGSFTSTGNFMSVVFITDGSVTRRGFQAYYYS 1465
Cdd:cd00041     81 LPPPIISSGNSLTVRFRSDSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1250-1347 7.43e-32

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 120.57  E-value: 7.43e-32
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1250 GQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1325
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1326 NFMSVVFITDGSVTRRGFQAHY 1347
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1008-1105 3.73e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.65  E-value: 3.73e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1008 GQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVCDGSNGS--FTSTG 1083
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1084 NFMSVVFITDGSVTRRGFQAHY 1105
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1124-1221 5.23e-31

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 118.26  E-value: 5.23e-31
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1124 GQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVCDGSNGS--FTSTG 1199
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1200 NFMSVVFITDGSVTRRGFQAHY 1221
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
1241-1347 2.02e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 116.63  E-value: 2.02e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1241 CGGLLTLPSGQFSSPHYPSNYPNNARCSWEILVPNMNRVTVAFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1317
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1318 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1347
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1357-1463 8.50e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 115.08  E-value: 8.50e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1357 CGGLLTQPSGQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVC-DGF 1433
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1434 NGSFTSTGNFMSVVFITDGSVTRRGFQAYY 1463
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
999-1105 9.74e-30

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 114.70  E-value: 9.74e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  999 CGGLLTQPSGQFSSPYYPSNYPNNARCSWKIVLPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPEYNSSLIARVC-DGS 1075
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1076 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1105
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB pfam00431
CUB domain;
1115-1221 1.87e-29

CUB domain;


Pssm-ID: 395345  Cd Length: 110  Bit Score: 113.93  E-value: 1.87e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051 1115 CGGLLTQPSGQFSSPYYPSNYPNNARCSWEILVPNMNRVTVVFTDVQLEG--GCNYDYILVYDGPQYNSSLIARVC-DGS 1191
Cdd:pfam00431    1 CGGVLTDSSGSISSPNYPNPYPPNKDCVWLIRAPPGFRVKLTFQDFELEDhdECGYDYVEIRDGPSASSPLLGRFCgSGI 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 1907177051 1192 NGSFTSTGNFMSVVFITDGSVTRRGFQAHY 1221
Cdd:pfam00431   81 PEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
1366-1463 1.90e-29

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 113.64  E-value: 1.90e-29
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907177051  1366 GQFSSPHYPSNYPNNVRCSWEILVPSMNRVTVAFTDVQLEG--GCSFDYILVYDGPEYNSSLIAPVCDGFNGS--FTSTG 1441
Cdd:smart00042    1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESsdNCEYDYVEIYDGPSASSPLLGRFCGSEAPPpvISSSS 80
                            90       100
                    ....*....|....*....|..
gi 1907177051  1442 NFMSVVFITDGSVTRRGFQAYY 1463
Cdd:smart00042   81 NSLTLTFVSDSSVQKRGFSARY 102
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH