NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568953943|ref|XP_006509108|]
View 

GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase isoform X1 [Mus musculus]

Protein Classification

GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase (domain architecture ID 10133525)

GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase catalyzes the addition of the 4th and 5th mannose residues to the dolichol-linked oligosaccharide chain, and is involved in the last steps of the synthesis of Man5GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GT4_ALG11-like cd03806
alpha-1,2-mannosyltransferase ALG11 and similar proteins; This family is most closely related ...
39-455 0e+00

alpha-1,2-mannosyltransferase ALG11 and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.


:

Pssm-ID: 340835 [Multi-domain]  Cd Length: 419  Bit Score: 700.52  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  39 VVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKLAHPVQFVF-LRKRYLVEDS 117
Cdd:cd03806    2 TVGFFHPYCNAGGGGERVLWCAVKATQKAYPNNICVIYTGDTDSSPEEILEKVESRFNIDLDSPRIVFFlLKYRKLVEAK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 118 RYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAF 197
Cdd:cd03806   82 TYPRFTLLGQALGSMILGFEALLKLVPDVFIDTMGYPFTYPLVRLLGGCPVVAYVHYPTISTDMLNKVRSREASYNNDST 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 198 ISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTpgHL 277
Cdd:cd03806  162 IARSSVLSIAKLLYYRLFAFLYGLAGSFADVVMVNSTWTYNHIRQLWKRNIKPSIVYPPCDTEELTKLPIDEKTRE--NQ 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 278 LVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELK 357
Cdd:cd03806  240 ILSIAQFRPEKNHPLQLRAFAELLKRLPESIRSNPKLVLIGSCRNEEDKERVEALKLLAKELILEDSVEFVVDAPYEELK 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 358 NYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQ 437
Cdd:cd03806  320 ELLSTASIGLHTMWNEHFGIGVVEYMAAGLIPLAHASAGPLLDIVVPWDGGPTGFLASTPEEYAEAIEKILTLSEEERLQ 399
                        410
                 ....*....|....*...
gi 568953943 438 IRKNARASISRFSDQEFE 455
Cdd:cd03806  400 RREAARSSAERFSDEEFE 417
 
Name Accession Description Interval E-value
GT4_ALG11-like cd03806
alpha-1,2-mannosyltransferase ALG11 and similar proteins; This family is most closely related ...
39-455 0e+00

alpha-1,2-mannosyltransferase ALG11 and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.


Pssm-ID: 340835 [Multi-domain]  Cd Length: 419  Bit Score: 700.52  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  39 VVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKLAHPVQFVF-LRKRYLVEDS 117
Cdd:cd03806    2 TVGFFHPYCNAGGGGERVLWCAVKATQKAYPNNICVIYTGDTDSSPEEILEKVESRFNIDLDSPRIVFFlLKYRKLVEAK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 118 RYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAF 197
Cdd:cd03806   82 TYPRFTLLGQALGSMILGFEALLKLVPDVFIDTMGYPFTYPLVRLLGGCPVVAYVHYPTISTDMLNKVRSREASYNNDST 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 198 ISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTpgHL 277
Cdd:cd03806  162 IARSSVLSIAKLLYYRLFAFLYGLAGSFADVVMVNSTWTYNHIRQLWKRNIKPSIVYPPCDTEELTKLPIDEKTRE--NQ 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 278 LVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELK 357
Cdd:cd03806  240 ILSIAQFRPEKNHPLQLRAFAELLKRLPESIRSNPKLVLIGSCRNEEDKERVEALKLLAKELILEDSVEFVVDAPYEELK 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 358 NYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQ 437
Cdd:cd03806  320 ELLSTASIGLHTMWNEHFGIGVVEYMAAGLIPLAHASAGPLLDIVVPWDGGPTGFLASTPEEYAEAIEKILTLSEEERLQ 399
                        410
                 ....*....|....*...
gi 568953943 438 IRKNARASISRFSDQEFE 455
Cdd:cd03806  400 RREAARSSAERFSDEEFE 417
PLN02949 PLN02949
transferase, transferring glycosyl groups
39-467 0e+00

transferase, transferring glycosyl groups


Pssm-ID: 215511 [Multi-domain]  Cd Length: 463  Bit Score: 546.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  39 VVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKLAHPVQFVFLRKRYLVEDSR 118
Cdd:PLN02949  35 AVGFFHPYTNDGGGGERVLWCAVRAIQEENPDLDCVIYTGDHDASPDSLAARARDRFGVELLSPPKVVHLRKRKWIEEET 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 119 YPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKyVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAFI 198
Cdd:PLN02949 115 YPRFTMIGQSLGSVYLAWEALCKFTPLYFFDTSGYAFTYPLAR-LFGCKVVCYTHYPTISSDMISRVRDRSSMYNNDASI 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 199 SRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTPghLL 278
Cdd:PLN02949 194 ARSFWLSTCKILYYRAFAWMYGLVGRCAHLAMVNSSWTKSHIEALWRIPERIKRVYPPCDTSGLQALPLERSEDPP--YI 271
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 279 VSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSlKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELKN 358
Cdd:PLN02949 272 ISVAQFRPEKAHALQLEAFALALEKLDADVPRP-KLQFVGSCRNKEDEERLQKLKDRAKELGLDGDVEFHKNVSYRDLVR 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 359 YLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQI 438
Cdd:PLN02949 351 LLGGAVAGLHSMIDEHFGISVVEYMAAGAVPIAHNSAGPKMDIVLDEDGQQTGFLATTVEEYADAILEVLRMRETERLEI 430
                        410       420
                 ....*....|....*....|....*....
gi 568953943 439 RKNARASISRFSDQEFEVAFLCSMEKLLT 467
Cdd:PLN02949 431 AAAARKRANRFSEQRFNEDFKDAIRPILN 459
ALG11_N pfam15924
ALG11 mannosyltransferase N-terminus;
38-244 1.44e-146

ALG11 mannosyltransferase N-terminus;


Pssm-ID: 406369  Cd Length: 208  Bit Score: 416.50  E-value: 1.44e-146
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943   38 TVVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKL-AHPVQFVFLRKRYLVED 116
Cdd:pfam15924   1 VIVGFFHPYCNAGGGGERVLWCAVRATQRRYPNAICVVYTGDIDASKEEILAKVKSRFNIKLdPSRIVFVYLRKRKLVEA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  117 SRYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAA 196
Cdd:pfam15924  81 STYPRFTLLGQSLGSMILAWEALSKLVPDVFIDTMGYAFTYPLVKLLGGCPVGAYVHYPTISTDMLSRVKSREAGYNNDS 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 568953943  197 FISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLW 244
Cdd:pfam15924 161 AIASSGLLSKAKLLYYRLFAFLYGLVGSFADVVMVNSSWTQNHIRSLW 208
RfaB COG0438
Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis]; ...
198-450 2.56e-23

Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 223515 [Multi-domain]  Cd Length: 381  Bit Score: 101.18  E-value: 2.56e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 198 ISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWkVGHCTNIVYPPCDVQTFLDIPLHEKKVTPGHL 277
Cdd:COG0438  123 ILLLPRLLLLLGLLRLLLKRLKKALRLLADRVIAVSPALKELLEALG-VPNKIVVIPNGIDTEKFAPARIGLLPEGGKFV 201
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 278 LVSIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGgcrnkDDEFRVNQLRSLSENLGVQENVEFKINISFDELK 357
Cdd:COG0438  202 VLYVGRLDPEKGLDLLIEAAAKLKKR-----GPDIKLVIVG-----DGPERREELEKLAKKLGLEDNVKFLGYVPDEELA 271
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 358 NYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEgqiTGFLAE--SEEGYADSMAHILSLSAEER 435
Cdd:COG0438  272 ELLASADVFVLPSLSEGFGLVLLEAMAAGTPVIASDVGGIP-EVVEDGE---TGLLVPpgDVEELADALEQLLEDPELRE 347
                        250
                 ....*....|....*
gi 568953943 436 LQIRKNARASISRFS 450
Cdd:COG0438  348 ELGEAARERVEEEFS 362
 
Name Accession Description Interval E-value
GT4_ALG11-like cd03806
alpha-1,2-mannosyltransferase ALG11 and similar proteins; This family is most closely related ...
39-455 0e+00

alpha-1,2-mannosyltransferase ALG11 and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.


Pssm-ID: 340835 [Multi-domain]  Cd Length: 419  Bit Score: 700.52  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  39 VVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKLAHPVQFVF-LRKRYLVEDS 117
Cdd:cd03806    2 TVGFFHPYCNAGGGGERVLWCAVKATQKAYPNNICVIYTGDTDSSPEEILEKVESRFNIDLDSPRIVFFlLKYRKLVEAK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 118 RYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAF 197
Cdd:cd03806   82 TYPRFTLLGQALGSMILGFEALLKLVPDVFIDTMGYPFTYPLVRLLGGCPVVAYVHYPTISTDMLNKVRSREASYNNDST 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 198 ISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTpgHL 277
Cdd:cd03806  162 IARSSVLSIAKLLYYRLFAFLYGLAGSFADVVMVNSTWTYNHIRQLWKRNIKPSIVYPPCDTEELTKLPIDEKTRE--NQ 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 278 LVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELK 357
Cdd:cd03806  240 ILSIAQFRPEKNHPLQLRAFAELLKRLPESIRSNPKLVLIGSCRNEEDKERVEALKLLAKELILEDSVEFVVDAPYEELK 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 358 NYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQ 437
Cdd:cd03806  320 ELLSTASIGLHTMWNEHFGIGVVEYMAAGLIPLAHASAGPLLDIVVPWDGGPTGFLASTPEEYAEAIEKILTLSEEERLQ 399
                        410
                 ....*....|....*...
gi 568953943 438 IRKNARASISRFSDQEFE 455
Cdd:cd03806  400 RREAARSSAERFSDEEFE 417
PLN02949 PLN02949
transferase, transferring glycosyl groups
39-467 0e+00

transferase, transferring glycosyl groups


Pssm-ID: 215511 [Multi-domain]  Cd Length: 463  Bit Score: 546.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  39 VVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKLAHPVQFVFLRKRYLVEDSR 118
Cdd:PLN02949  35 AVGFFHPYTNDGGGGERVLWCAVRAIQEENPDLDCVIYTGDHDASPDSLAARARDRFGVELLSPPKVVHLRKRKWIEEET 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 119 YPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKyVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAFI 198
Cdd:PLN02949 115 YPRFTMIGQSLGSVYLAWEALCKFTPLYFFDTSGYAFTYPLAR-LFGCKVVCYTHYPTISSDMISRVRDRSSMYNNDASI 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 199 SRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTPghLL 278
Cdd:PLN02949 194 ARSFWLSTCKILYYRAFAWMYGLVGRCAHLAMVNSSWTKSHIEALWRIPERIKRVYPPCDTSGLQALPLERSEDPP--YI 271
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 279 VSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSlKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELKN 358
Cdd:PLN02949 272 ISVAQFRPEKAHALQLEAFALALEKLDADVPRP-KLQFVGSCRNKEDEERLQKLKDRAKELGLDGDVEFHKNVSYRDLVR 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 359 YLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQI 438
Cdd:PLN02949 351 LLGGAVAGLHSMIDEHFGISVVEYMAAGAVPIAHNSAGPKMDIVLDEDGQQTGFLATTVEEYADAILEVLRMRETERLEI 430
                        410       420
                 ....*....|....*....|....*....
gi 568953943 439 RKNARASISRFSDQEFEVAFLCSMEKLLT 467
Cdd:PLN02949 431 AAAARKRANRFSEQRFNEDFKDAIRPILN 459
ALG11_N pfam15924
ALG11 mannosyltransferase N-terminus;
38-244 1.44e-146

ALG11 mannosyltransferase N-terminus;


Pssm-ID: 406369  Cd Length: 208  Bit Score: 416.50  E-value: 1.44e-146
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943   38 TVVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKL-AHPVQFVFLRKRYLVED 116
Cdd:pfam15924   1 VIVGFFHPYCNAGGGGERVLWCAVRATQRRYPNAICVVYTGDIDASKEEILAKVKSRFNIKLdPSRIVFVYLRKRKLVEA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  117 SRYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTLPLFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAA 196
Cdd:pfam15924  81 STYPRFTLLGQSLGSMILAWEALSKLVPDVFIDTMGYAFTYPLVKLLGGCPVGAYVHYPTISTDMLSRVKSREAGYNNDS 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 568953943  197 FISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLW 244
Cdd:pfam15924 161 AIASSGLLSKAKLLYYRLFAFLYGLVGSFADVVMVNSSWTQNHIRSLW 208
GT4_ALG2-like cd03805
alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins; This family is most closely ...
157-454 7.01e-35

alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.


Pssm-ID: 340834 [Multi-domain]  Cd Length: 392  Bit Score: 133.87  E-value: 7.01e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 157 LPLFKYVGGCRVGSYVHYPtistDMLSVvknqnpgfnnaafiSRNALLskaKLIYYYLFAFVYGLVGSCSDIVMVNSSWT 236
Cdd:cd03805  107 VPLLKLFRPSKILFYCHFP----DQLLA--------------QRKSLL---KRLYRKPFDWLEEFTTGMADQIVVNSNFT 165
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 237 LNHIL----SLWKVGHctNIVYPPCDVQTF-----LDIPLHEKKVTPGHLLVSIGQFRPEKNHALQIKAFAKLLNEKAaE 307
Cdd:cd03805  166 AGVFKktfpSLAKNPP--EVLYPCVDTDSFdstseDPDPGDLIAKSNKKFFLSINRFERKKNIALAIEAFAKLKQKLP-E 242
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 308 LGHsLKLVLIGGCrnkddEFRV-------NQLRSLSENL-GVQENVEFKINISfDELKNYL-SEATIGLHTMWNEHFGIG 378
Cdd:cd03805  243 FEN-VRLVIAGGY-----DPRVaenveylEELQRLAEELlNVEDQVLFLRSIS-DSQKEQLlSSALALLYTPSNEHFGIV 315
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 568953943 379 VVECMAAGTVILAHNSGGPKLDIViphEGqITGFLAESE-EGYADSMAHILSLSaEERLQIRKNARASIS-RFSDQEF 454
Cdd:cd03805  316 PLEAMYAGKPVIACNSGGPLETVV---EG-VTGFLCEPTpEAFAEAMLKLANDP-DLADRMGAAGRKRVKeKFSREAF 388
Glycos_transf_1 pfam00534
Glycosyl transferases group 1; Mutations in this domain of PIGA lead to disease (Paroxysmal ...
277-443 1.01e-27

Glycosyl transferases group 1; Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.


Pssm-ID: 395425 [Multi-domain]  Cd Length: 158  Bit Score: 108.12  E-value: 1.01e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  277 LLVSIGQFRPEKNHALQIKAFAKLLnekaaELGHSLKLVLIGGCRNKDdefrvnQLRSLSENLGVQENVEFKINISFDEL 356
Cdd:pfam00534   4 IILFVGRLEPEKGLDLLIKAFALLK-----EQHPNLKLVIAGDGEEEK------RLKKLAEKLGLGDNVIFLGFVSDEDL 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  357 KNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEgqiTGFLAE--SEEGYADSMAHILSLSaEE 434
Cdd:pfam00534  73 PELYKIADLFVLPSRYEGFGIVLLEAMACGTPVIASDVGGPP-EVVKDGE---TGFLVKpnNAEALAEAIDKLLEDE-EL 147

                  ....*....
gi 568953943  435 RLQIRKNAR 443
Cdd:pfam00534 148 RERLGENAR 156
GT4_PimA-like cd03801
phosphatidyl-myo-inositol mannosyltransferase; This family is most closely related to the GT4 ...
40-450 2.27e-23

phosphatidyl-myo-inositol mannosyltransferase; This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.


Pssm-ID: 340831 [Multi-domain]  Cd Length: 366  Bit Score: 101.08  E-value: 2.27e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  40 VAFFHPYCNAG-GGGERVLWCALRALQKKyPEAVYVVYTGDINVSgqqilDGAFRRFNIKLAHPVQFVFLRKRYLVEDSR 118
Cdd:cd03801    2 ILLLSPELPPPvGGAERHVRELARALAAR-GHDVTVLTPADPGEP-----PEELEDGVIVPLLPSLAALLRARRLLRELR 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 119 YphftllgqslgsillgweALMQRVPD-VYIDSMGYAFTLPLFKYVGGCRVGSYVHyptistdmlsvvkNQNPGFNNAAF 197
Cdd:cd03801   76 P------------------LLRLRKFDvVHAHGLLAALLAALLALLLGAPLVVTLH-------------GAEPGRLLLLL 124
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 198 ISRNALLSKAKLIYYYlfafvyglvgscSDIVMVNSSWTLNHILSLWKVGHCTNIV-YPPCDVQTFLDIPLHEKKVTPGH 276
Cdd:cd03801  125 AAERRLLARAEALLRR------------ADAVIAVSEALRDELRALGGIPPEKIVViPNGVDLERFSPPLRRKLGIPPDR 192
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 277 -LLVSIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGGcrnkDDEFRvNQLRSLSenLGVQENVEFKINISFDE 355
Cdd:cd03801  193 pVLLFVGRLSPRKGVDLLLEALAKLLRR-----GPDVRLVIVGG----DGPLR-AELEELE--LGLGDRVRFLGFVPDEE 260
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 356 LKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEGqitGFLAESE--EGYADSMAHILSlSAE 433
Cdd:cd03801  261 LPALYAAADVFVLPSRYEGFGLVVLEAMAAGLPVVATDVGGLP-EVVEDGEG---GLVVPPDdvEALADALLRLLA-DPE 335
                        410
                 ....*....|....*...
gi 568953943 434 ERLQIRKNARASIS-RFS 450
Cdd:cd03801  336 LRARLGRAARERVAeRFS 353
RfaB COG0438
Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis]; ...
198-450 2.56e-23

Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 223515 [Multi-domain]  Cd Length: 381  Bit Score: 101.18  E-value: 2.56e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 198 ISRNALLSKAKLIYYYLFAFVYGLVGSCSDIVMVNSSWTLNHILSLWkVGHCTNIVYPPCDVQTFLDIPLHEKKVTPGHL 277
Cdd:COG0438  123 ILLLPRLLLLLGLLRLLLKRLKKALRLLADRVIAVSPALKELLEALG-VPNKIVVIPNGIDTEKFAPARIGLLPEGGKFV 201
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 278 LVSIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGgcrnkDDEFRVNQLRSLSENLGVQENVEFKINISFDELK 357
Cdd:COG0438  202 VLYVGRLDPEKGLDLLIEAAAKLKKR-----GPDIKLVIVG-----DGPERREELEKLAKKLGLEDNVKFLGYVPDEELA 271
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 358 NYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEgqiTGFLAE--SEEGYADSMAHILSLSAEER 435
Cdd:COG0438  272 ELLASADVFVLPSLSEGFGLVLLEAMAAGTPVIASDVGGIP-EVVEDGE---TGLLVPpgDVEELADALEQLLEDPELRE 347
                        250
                 ....*....|....*
gi 568953943 436 LQIRKNARASISRFS 450
Cdd:COG0438  348 ELGEAARERVEEEFS 362
GT4_MtfB-like cd03809
glycosyltransferases MtfB, WbpX, and similar proteins; This family is most closely related to ...
51-450 1.30e-18

glycosyltransferases MtfB, WbpX, and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.


Pssm-ID: 340838 [Multi-domain]  Cd Length: 362  Bit Score: 87.03  E-value: 1.30e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  51 GGGERVLWCALRALQKKYPEAVYVVytgdinVSGQQILDGAFRRFNIKLAHPVQFVFLRKRYLvedsryphftllgqslG 130
Cdd:cd03809   14 TGIGRYTRELLKALAKNDPDESVLA------VPPLPGELLRLLREYPELSLGVIKIKLWRELA----------------L 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 131 SILLGWEALMQRVPDVYIdsmGYAFTLPLFKYvgGCRVGSYVHyptistdmlsvvknqnpgfnNAAFISRNALLSKAKLI 210
Cdd:cd03809   72 LRWLQILLPKKDKPDLLH---SPHNTAPLLLK--GCPQVVTIH--------------------DLIPLRYPEFFPKRFRL 126
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 211 YYYLFafvYGLVGSCSDIVMVNSSWTLNHILSLWKVGhCTNIVYPPCDVQTFLDIPLHEKKVTPGHLL-----VSIGQFR 285
Cdd:cd03809  127 YYRLL---LPISLRRADAIITVSEATRDDIIKFYGVP-PEKIVVIPLGVDPSFFPPESAAVLIAKYLLpepyfLYVGTLE 202
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 286 PEKNHALQIKAFAKLlnekaAELGHSLKLVLIGGCRNKDDEfrvnqLRSLSENLGVQENVEFKINISFDELKNYLSEATI 365
Cdd:cd03809  203 PRKNHERLLKAFALL-----KKQGGDLKLVIVGGKGWEDEE-----LLDLVKKLGLGGRVRFLGYVSDEDLPALYRGARA 272
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 366 ----GLHtmwnEHFGIGVVECMAAGTVILAHNSGgpkldiVIPHEGQITGFL--AESEEGYADSMAHILSlSAEERLQIR 439
Cdd:cd03809  273 fvfpSLY----EGFGLPVLEAMACGTPVIASNIS------VLPEVAGDAALYfdPLDPESIADAILRLLE-DPSLREELI 341
                        410
                 ....*....|.
gi 568953943 440 KNARASISRFS 450
Cdd:cd03809  342 RKGLERAKKFS 352
Glycosyltransferase_GTB-type cd01635
glycosyltransferase family 1 and related proteins with GTB topology; Glycosyltransferases ...
207-407 3.73e-15

glycosyltransferase family 1 and related proteins with GTB topology; Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.


Pssm-ID: 340816 [Multi-domain]  Cd Length: 235  Bit Score: 74.75  E-value: 3.73e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 207 AKLIYYYLFAFVYGLVGSCsDIVMVNSSWTLNHILSL------WKVGHCTNIVYPPCDVQTFLDIPLHEKKVTPGHLLVS 280
Cdd:cd01635   37 ALLLLALRRILKKLLELKP-DVVHAHSPHAAALAALLaarllgIPIVVTVHGPDSLESTRSELLALARLLVSLPLADKVS 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 281 IGQFRPEKNHALQIKAFAKLlnekaAELGHSLKLVLIGGCRNKDDEFRvnqlrsLSENLGVQENVEFKINISFDELKNYL 360
Cdd:cd01635  116 VGRLVPEKGIDLLLEALALL-----KARLPDLVLVLVGGGGEREEEEA------LAAALGLLERVVIIGGLVDDEVLELL 184
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 568953943 361 SE-ATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEG 407
Cdd:cd01635  185 LAaADVFVLPSRSEGFGLVLLEAMAAGKPVIATDVGGIPEFVVDGENG 232
GT4_sucrose_synthase cd03800
sucrose-phosphate synthase and similar proteins; This family is most closely related to the ...
250-449 8.79e-15

sucrose-phosphate synthase and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.


Pssm-ID: 340830 [Multi-domain]  Cd Length: 398  Bit Score: 75.74  E-value: 8.79e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 250 TNIVYPPCDVQTF---LDIPLHEKKVtpghllVSIGQFRPEKNHALQIKAFAKLlnekaAELGHSLKLVLIGGCRNKDDE 326
Cdd:cd03800  198 LERFFPVDRAEARrarLLLPPDKPVV------LALGRLDPRKGIDTLVRAFAQL-----PELRELANLVLVGGPSDDPLS 266
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 327 FRVNQLRSLSENLGVQENVEFKINISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPhe 406
Cdd:cd03800  267 MDREELAELAEELGLIDRVRFPGRVSRDDLPELYRAADVFVVPSLYEPFGLTAIEAMACGTPVVATAVGGLQ-DIVRD-- 343
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 568953943 407 gQITGFLAE--SEEGYADSMAHILSlSAEERLQIRKNARASISRF 449
Cdd:cd03800  344 -GRTGLLVDphDPEALAAALRRLLD-DPALWQRLSRAGLERARAH 386
GT4_WbnK-like cd03807
Shigella dysenteriae WbnK and similar proteins; This family is most closely related to the GT4 ...
277-450 1.37e-14

Shigella dysenteriae WbnK and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.


Pssm-ID: 340836 [Multi-domain]  Cd Length: 362  Bit Score: 75.05  E-value: 1.37e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 277 LLVSIGQFRPEKNHALQIKAFAKLlnekaAELGHSLKLVLIG-GCRNKDDEfrvnqlrSLSENLGVQENVEFKINISfdE 355
Cdd:cd03807  192 VIGIVGRLHPVKDHSDLLRAAALL-----VETHPDLRLLLVGrGPERPNLE-------RLLLELGLEDRVHLLGERS--D 257
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 356 LKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGpKLDIVIPHegqiTGFL--AESEEGYADSMAHILSLsAE 433
Cdd:cd03807  258 VPALLPAMDIFVLSSRTEGFPNALLEAMACGLPVVATDVGG-AAELVDDG----TGFLvpAGDPQALADAIRALLED-PE 331
                        170
                 ....*....|....*...
gi 568953943 434 ERLQIRKNARASI-SRFS 450
Cdd:cd03807  332 KRARLGRAARERIaNEFS 349
GT4_AviGT4-like cd03802
UDP-Glc:tetrahydrobiopterin alpha-glucosyltransferase and similar proteins; This family is ...
274-452 2.84e-14

UDP-Glc:tetrahydrobiopterin alpha-glucosyltransferase and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.


Pssm-ID: 340832 [Multi-domain]  Cd Length: 333  Bit Score: 73.48  E-value: 2.84e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 274 PGHLLVsIGQFRPEKNHALQIKAfakllnekAAELGhsLKLVLIGGCRNKDDEFRVNQLRslsenlgVQENVEFKINISF 353
Cdd:cd03802  169 EDYLAF-LGRIAPEKGLEDAIRV--------ARRAG--LPLKIAGKVRDEDYFYYLQEPL-------PGPRIEFIGEVGH 230
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 354 DELKNYLSEATIGLHT-MWNEHFGIGVVECMAAGTVILAHNSGGPkLDIVIPHEgqiTGFLAESEEGYADSMAHILSLSa 432
Cdd:cd03802  231 DEKQELLGGARALLFPiNWDEPFGLVMIEAMACGTPVIAYRRGGL-PEVIQHGE---TGFLVDSVEEMAEAIANIDRID- 305
                        170       180
                 ....*....|....*....|..
gi 568953943 433 eeRLQIRKNA--RASISRFSDQ 452
Cdd:cd03802  306 --RAACRRYAedRFSAARMADR 325
GT4_WbaZ-like cd03804
mannosyltransferase WbaZ and similar proteins; This family is most closely related to the GT4 ...
227-458 2.36e-13

mannosyltransferase WbaZ and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. WbaZ in Salmonella enterica has been shown to possess mannosyltransferase activity.


Pssm-ID: 340833 [Multi-domain]  Cd Length: 356  Bit Score: 71.16  E-value: 2.36e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 227 DIVMVNSSWTLNHIlslWKVGHCTNIV-YPPCDVQTFLdiPLHEKkvtpGHLLVSIGQFRPEKNHALQIKAFAKLlneka 305
Cdd:cd03804  159 DLFIANSQFVARRI---KKFYGRESTViYPPVDTDAFA--PAADK----EDYYLTASRLVPYKRIDLAVEAFNEL----- 224
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 306 aelghSLKLVLIGgcrnkdDEFRVNQLRSLSenlgvQENVEFKINISFDELKNYLSEATiGLHTMWNEHFGIGVVECMAA 385
Cdd:cd03804  225 -----PKRLVVIG------DGPDLDRLRAMA-----SPNVEFLGYQPDEVLKELLSKAR-AFVFAAEEDFGIVPVEAQAC 287
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568953943 386 GTVILAHNSGGpKLDIVIPHEgqiTGFLAesEEGYADSMAHILSLSAEERLQIRKNA-RASISRFSDQEFEVAF 458
Cdd:cd03804  288 GTPVIAFGKGG-ALETVRPGP---TGILF--GEQTVESLKAAVEEFEQNFDRFKPQAiRANAERFSRARFRQEI 355
GT4_UGDG-like cd03817
UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins; This family is most ...
277-450 7.10e-13

UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins; This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.


Pssm-ID: 340844 [Multi-domain]  Cd Length: 372  Bit Score: 69.62  E-value: 7.10e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 277 LLVSIGQFRPEKNHALQIKAFAKLLNEKAAelghslKLVLIGGcrNKDDEfrvnQLRSLSENLGVQENVEFKINISFDEL 356
Cdd:cd03817  203 ILLYVGRLAKEKNIDFLLRAFAELKKEPNI------KLVIVGD--GPERE----ELKELARELGLADKVIFTGFVPREEL 270
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 357 KNYLSEATIGLHTMWNEHFGIGVVECMAAGT-VILAHNSGGPklDIVipHEGqITGFLAESEEGY-ADSMAHILSLsAEE 434
Cdd:cd03817  271 PEYYKAADLFVFASTTETQGLVYLEAMAAGLpVVAAKDPAAS--ELV--EDG-ENGFLFEPNDETlAEKLLHLREN-LEL 344
                        170
                 ....*....|....*.
gi 568953943 435 RLQIRKNARASISRFS 450
Cdd:cd03817  345 LRKLSKNAEISAREFA 360
GT4_WlbH-like cd03798
Bordetella parapertussis WlbH and similar proteins; This family is most closely related to the ...
225-454 1.37e-12

Bordetella parapertussis WlbH and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.


Pssm-ID: 340828 [Multi-domain]  Cd Length: 376  Bit Score: 68.95  E-value: 1.37e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 225 CSDIVmVNSSWTLNHILSLWKVGHCT---------------------NIVYPPCDVQTFLDIPLHE--KKVTPGHLLVSI 281
Cdd:cd03798  128 GSDIN-VFPPRSLLRKLLRWALRRAArviavskalaeelvalgvprdRVDVIPNGVDPARFQPEDRglGLPLDAFVILFV 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 282 GQFRPEKNHALQIKAFAKLlnEKAAElghSLKLVLIGGCRNKDdefrvnQLRSLSENLGVQENVEFKINISFDELKNYLS 361
Cdd:cd03798  207 GRLIPRKGIDLLLEAFARL--AKARP---DVVLLIVGDGPLRE------ALRALAEDLGLGDRVTFTGRLPHEQVPAYYR 275
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 362 EATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIViphEGQITGFLAE--SEEGYADSMAHILSLSAEERLQIR 439
Cdd:cd03798  276 ACDVFVLPSRHEGFGLVLLEAMACGLPVVATDVGGIP-EVV---GDPETGLLVPpgDADALAAALRRALAEPYLRELGEA 351
                        250
                 ....*....|....*
gi 568953943 440 KNARASiSRFSDQEF 454
Cdd:cd03798  352 ARARVA-ERFSWVKA 365
GT4_BshA-like cd04962
N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA and similar proteins; This family is most ...
226-450 3.45e-12

N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA and similar proteins; This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.


Pssm-ID: 340859 [Multi-domain]  Cd Length: 370  Bit Score: 67.76  E-value: 3.45e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 226 SDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIP---LHEKKVTP--GHLLVSIGQFRPEKNHALQIKAFAKL 300
Cdd:cd04962  142 SDRVTAVSSSLRQETYELFDVDKDIEVIHNFIDEDVFKRKPagaLKRRLLAPpdEKVVIHVSNFRPVKRIDDVVRVFARV 221
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 301 LNEKAAelghslKLVLIGgcrnkDDEFRVNqLRSLSENLGVQENVEFKINisFDELKNYLSEATIGLHTMWNEHFGIGVV 380
Cdd:cd04962  222 RRKIPA------KLLLVG-----DGPERVP-AEELARELGVEDRVLFLGK--QDDVEELLSIADLFLLPSEKESFGLAAL 287
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568953943 381 ECMAAGTVILAHNSGGpkLDIVIPHegQITGFLaeSEEGYADSMA-HILSLSAEERLQIR--KNARASI-SRFS 450
Cdd:cd04962  288 EAMACGVPVVSSNAGG--IPEVVKH--GETGFL--SDVGDVDAMAkSALSILEDDELYNRmgRAARKRAaERFD 355
Glyco_trans_1_4 pfam13692
Glycosyl transferases group 1;
275-429 5.58e-12

Glycosyl transferases group 1;


Pssm-ID: 404563 [Multi-domain]  Cd Length: 138  Bit Score: 62.92  E-value: 5.58e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943  275 GHLLVSIGQFRPE-KNHALQIKAFAKLLNEKaaelgHSLKLVLIGGCRNKddefrvnQLRSLSEnlGVQENVEFKINIsf 353
Cdd:pfam13692   1 RPVILFVGRLHPNvKGVDWLLEAVPLLRKRD-----NDVRLVIVGDGPEE-------ELEELAA--GLEDRVIFTGFV-- 64
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 568953943  354 DELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIphegQITGFLAESE--EGYADSMAHILS 429
Cdd:pfam13692  65 EDLAELLAAADVFVLPSLYEGFGLKLLEAMAAGLPVVATDVGGIP-ELVD----GENGLLVPPGdpEALAEAILRLLE 137
GT4_GT28_WabH-like cd03811
family 4 and family 28 glycosyltransferases similar to Klebsiella WabH; This family is most ...
252-455 2.03e-11

family 4 and family 28 glycosyltransferases similar to Klebsiella WabH; This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.


Pssm-ID: 340839 [Multi-domain]  Cd Length: 351  Bit Score: 65.07  E-value: 2.03e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 252 IVYPPCDVQTFLDIPLHEKKVTPGH--LLVSIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGgcrNKDDEfrv 329
Cdd:cd03811  163 VIYNPIDIDRIRALAKEPILNEPEDgpVILAVGRLDPQKGHDLLIEAFAKLRKK-----YPDVKLVILG---DGPLR--- 231
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 330 NQLRSLSENLGVQENVEFKinisfDELKN---YLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHE 406
Cdd:cd03811  232 EELEKLAKELGLAERVIFL-----GFQSNpypYLKKADLFVLSSRYEGFPNVLLEAMALGTPVVSTDCPGPR-EILDDGE 305
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 568953943 407 gqiTGFLAESEEGYADSMAHILSLSAEERLQIRKNARASISRFSDQEFE 455
Cdd:cd03811  306 ---NGLLVPDGDAAALAGILAALLQKKLDAALRERLAKAQEAVFREYTI 351
GT4_WbdM_like cd04951
LPS/UnPP-GlcNAc-Gal a-1,4-glucosyltransferase WbdM and similar proteins; This family is most ...
277-450 1.05e-08

LPS/UnPP-GlcNAc-Gal a-1,4-glucosyltransferase WbdM and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.


Pssm-ID: 340857 [Multi-domain]  Cd Length: 360  Bit Score: 56.68  E-value: 1.05e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 277 LLVSIGQFRPEKNHALQIKAFAKLLNEKaaelgHSLKLVLIGgcrnkDDEFRvNQLRSLSENLGVQENVEFKINISfdEL 356
Cdd:cd04951  190 VILNVGRLTEAKDYPNLLLAISELILSK-----NDFKLLIAG-----DGPLR-NELERLICNLNLVDRVILLGQIS--NI 256
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 357 KNYLSEATIG-LHTMWnEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEGQITgfLAESEEgYADSMAHILSLSAEER 435
Cdd:cd04951  257 SEYYNAADLFvLSSEW-EGFGLVVAEAMACERPVVATDAGGVA-EVVGDHNYVVP--VSDPQL-LAEKIKEIFDMSDEER 331
                        170
                 ....*....|....*
gi 568953943 436 LQIRKNARASISRFS 450
Cdd:cd04951  332 DILGNKNEYIAKNFS 346
GT4_ExpE7-like cd03823
glycosyltransferase ExpE7 and similar proteins; This family is most closely related to the GT4 ...
281-448 3.19e-08

glycosyltransferase ExpE7 and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).


Pssm-ID: 340850 [Multi-domain]  Cd Length: 357  Bit Score: 55.41  E-value: 3.19e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 281 IGQFRPEKNHALQIKAFAKLLNEKAaelghslKLVLIGGCRNKDDEFrvnqlrslsenLGVQENVEFKINISFDELKNYL 360
Cdd:cd03823  197 IGRLTEEKGIDLLVEAFKRLPREDI-------ELVIAGHGPLSDERQ-----------IEGGRRIAFLGRVPTDDIKDFY 258
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 361 SEATIGL-HTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQItgFLAESEEGYADSMAHILSLSAEERLqIR 439
Cdd:cd03823  259 EKIDVLVvPSIWPEPFGLVVREAIAAGLPVIASDLGGIAELIQPGVNGLL--FAPGDAEDLAAAMRRLLTDPALLER-LR 335

                 ....*....
gi 568953943 440 KNARASISR 448
Cdd:cd03823  336 AGAEPPRST 344
GT4_AmsD-like cd03820
amylovoran biosynthesis glycosyltransferase AmsD and similar proteins; This family is most ...
262-450 7.15e-08

amylovoran biosynthesis glycosyltransferase AmsD and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.


Pssm-ID: 340847 [Multi-domain]  Cd Length: 351  Bit Score: 54.17  E-value: 7.15e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 262 FLDIPLHEKKVTP-GHLLVSIGQFRPEKNHALQIKAFAKLLNEKAAelghsLKLVLIGGCRNKDdefrvnQLRSLSENLG 340
Cdd:cd03820  167 PLSFPSEEPSTNLkSKRILAVGRLTYQKGFDLLIEAWALIAKKHPD-----WKLRIYGDGPERE------ELEKLIDKLG 235
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 341 VQENVEFKINISfdELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNS-GGPKlDIVIPHEgqiTGFLAESE-- 417
Cdd:cd03820  236 LEDRVKLLGPTK--NIAEEYANSSIFVLSSRYEGFPMVLLEAMAYGLPIISFDCpTGPS-EIIEDGE---NGLLVPNGdv 309
                        170       180       190
                 ....*....|....*....|....*....|...
gi 568953943 418 EGYADSMAHILSlSAEERLQIRKNARASISRFS 450
Cdd:cd03820  310 DALAEALLRLME-DEELRKKMGKNARKNAERFS 341
GT4_WbuB-like cd03794
Escherichia coli WbuB and similar proteins; This family is most closely related to the GT1 ...
294-466 8.96e-08

Escherichia coli WbuB and similar proteins; This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.


Pssm-ID: 340825 [Multi-domain]  Cd Length: 391  Bit Score: 53.89  E-value: 8.96e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 294 IKAFAKLLNEKaaelghSLKLVLIGGCRNKDdefrvnQLRSLSENLGVQeNVEFKINISFDELKNYLSEATIGLHTMWNE 373
Cdd:cd03794  236 LEAAERLKRRP------DIRFLFVGDGDEKE------RLKELAKARGLD-NVTFLGRVPKEEVPELLSAADVGLVPLKDN 302
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 374 HFGIGVV-----ECMAAGTVILAHNSGGPKLDIVIphegQITGFLAESEEgyADSMAH-ILSLSA--EERLQIRKNARas 445
Cdd:cd03794  303 PANRGSSpsklfEYMAAGKPILASDDGGSDLAVEI----NGCGLVVEPGD--PEALADaILELLDdpELRRAMGENGR-- 374
                        170       180
                 ....*....|....*....|.
gi 568953943 446 isRFSDQEFEVAFLcsMEKLL 466
Cdd:cd03794  375 --ELAEEKFSREKL--ADRLL 391
GT4_WavL-like cd03819
Vibrio cholerae WavL and similar sequences; This family is most closely related to the GT4 ...
281-449 1.13e-07

Vibrio cholerae WavL and similar sequences; This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.


Pssm-ID: 340846 [Multi-domain]  Cd Length: 345  Bit Score: 53.51  E-value: 1.13e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 281 IGQFRPEKNHALQIKAFAKLLNEKAAELghslklvLIGGcrnkdDEFRVNQLRSLSENLGVQENVEFKINIsfDELKNYL 360
Cdd:cd03819  188 VGRLSPEKGWLLLVDAAAELKDEPDFRL-------LVAG-----DGPERDEIRRLVERLGLRDRVTFTGFR--EDVPAAL 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 361 SEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPkLDIVIPHEgqiTGFLaeSEEGYADSMA-----HILSLSAEER 435
Cdd:cd03819  254 AASDVVVLPSLHEEFGRVALEAMACGTPVVATDVGGA-REIVVHGR---TGLL--VPPGDAEALAdairaAKLLPEAREK 327
                        170
                 ....*....|....
gi 568953943 436 LQIRKNARASISRF 449
Cdd:cd03819  328 LQAAAALTEAVREL 341
GT4-like cd03814
glycosyltransferase family 4 proteins; This family is most closely related to the GT4 family ...
196-459 1.50e-07

glycosyltransferase family 4 proteins; This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.


Pssm-ID: 340842 [Multi-domain]  Cd Length: 365  Bit Score: 53.07  E-value: 1.50e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 196 AFISRNALLSKAKLIYYYLFAFvYGlvgsCSDIVMVNSSWTLNHI-------LSLWKVGHCTNIVYP-PCDvQTFLDIPL 267
Cdd:cd03814  121 EYLSYYTLGPLSWLAWAYLRWF-HN----PFDTTLVPSPSIARELeghgferVRLWPRGVDTELFHPsRRD-AALRRRLG 194
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 268 HEKKVtpghLLVSIGQFRPEKNHALQIKAFAKLLNEKaaelghSLKLVLIGGCRNKddefRVNQLRSLsenlgvqeNVEF 347
Cdd:cd03814  195 PPGRP----LLLYVGRLAPEKNLEALLDADLPLAASP------PVRLVVVGDGPAR----AELEARGP--------DVIF 252
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 348 KINISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEgqiTGFLAES--EEGYADSMA 425
Cdd:cd03814  253 TGFLTGEELARAYASADVFVFPSRTETFGLVVLEAMASGLPVVAADAGGPR-DIVRPGG---TGALVEPgdAAAFAAALR 328
                        250       260       270
                 ....*....|....*....|....*....|....
gi 568953943 426 HiLSLSAEERLQIRKNARASISRFSDQEFEVAFL 459
Cdd:cd03814  329 A-LLEDPELRRRMAARARAEAERYSWEAFLDNLL 361
GT4-like cd03813
glycosyltransferase family 4 proteins; This family is most closely related to the GT4 family ...
250-453 8.29e-07

glycosyltransferase family 4 proteins; This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.


Pssm-ID: 340841 [Multi-domain]  Cd Length: 474  Bit Score: 51.18  E-value: 8.29e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 250 TNIVYPPCDVQTFLDIPLHEKKVTPGHLlVSIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGGcrNKDDEFRV 329
Cdd:cd03813  269 TRVIPNGIDIQRFAPAREERPEKEPPVV-GLVGRVVPIKDVKTFIRAFKLVRRA-----MPDAEGWLIGP--EDEDPEYA 340
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 330 NQLRSLSENLGVQENVEFkinISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKlDIViphEGQI 409
Cdd:cd03813  341 QECKRLVASLGLENKVKF---LGFQNIKEYYPKLGLLVLTSISEGQPLVILEAMASGVPVVATDVGSCR-ELI---YGAD 413
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 568953943 410 TGFLAESE----EGYADSMAHILSL--SAEERLQIRKNARASISRFSDQE 453
Cdd:cd03813  414 DALGQAGLvvppADPEALAEALIKLlrDPELRQAFGEAGRKRVEKYYTLE 463
GT4_GtfA-like cd04949
accessory Sec system glycosyltransferase GtfA and similar proteins; This family is most ...
276-451 1.97e-06

accessory Sec system glycosyltransferase GtfA and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.


Pssm-ID: 340855 [Multi-domain]  Cd Length: 328  Bit Score: 49.61  E-value: 1.97e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 276 HLLVSIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGgcrnKDDEFrvNQLRSLSENLGVQENVEFKINISfDE 355
Cdd:cd04949  161 NKIITISRLAPEKQLDHLIEAVAKAVKK-----VPEITLDIYG----YGEER--EKLKKLIEELHLEDNVFLKGYHS-NL 228
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 356 LKNYlSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSG-GPKlDIVIPHEgqiTGFLAESE--EGYADSMAHILsLSA 432
Cdd:cd04949  229 DQEY-QDAYLSLLTSQMEGFGLTLMEAIGHGLPVVSYDVKyGPS-ELIEDGE---NGYLIEKNniDALADKIIELL-NDP 302
                        170
                 ....*....|....*....
gi 568953943 433 EERLQIRKNARASISRFSD 451
Cdd:cd04949  303 EKLQQFSEESYKIAEKYST 321
GT4_trehalose_phosphorylase cd03792
trehalose phosphorylase and similar proteins; Trehalose phosphorylase (TP) reversibly ...
251-448 1.47e-05

trehalose phosphorylase and similar proteins; Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.


Pssm-ID: 340823 [Multi-domain]  Cd Length: 378  Bit Score: 46.93  E-value: 1.47e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 251 NIVYPPCDVQTFLDIPLhekKVTPGH-LLVSIGQFRPEKNHALQIKAFaKLLNEKAAELghslKLVLIGGCRNKDDEFRV 329
Cdd:cd03792  175 NKDLSPADIRYYLEKPF---VIDPERpYILQVARFDPSKDPLGVIDAY-KLFKRRAEEP----QLVICGHGAVDDPEGSV 246
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 330 --NQLRSLSENlgvQENVEFKINISFDELKN-YLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIviphE 406
Cdd:cd03792  247 vyEEVMEYAGD---DHDIHVLRLPPSDQEINaLQRAATVVLQLSTREGFGLTVSEALWKGKPVIATPAGGIPLQV----I 319
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 568953943 407 GQITGFLAESEEGYAdsmAHILSLSAEERL--QIRKNARASISR 448
Cdd:cd03792  320 DGETGFLVNSVEGAA---VRILRLLTDPELrrKMGLAAREHVRD 360
GT4_WcaC-like cd03825
putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins; This family ...
277-452 1.13e-04

putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.


Pssm-ID: 340851 [Multi-domain]  Cd Length: 364  Bit Score: 44.24  E-value: 1.13e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 277 LLVSIGQFRPEKNHALQIKAFAKLLNEKaaelghSLKLVLIGGC--RNKDDEFRVNqlrslseNLGVQENVEfkinisfd 354
Cdd:cd03825  197 LFGAESVTKPRKGFDELIEALKLLATKD------DLLLVVFGKNdpQIVILPFDII-------SLGYIDDDE-------- 255
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 355 ELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPkLDIVIPHEgqiTGFLA--ESEEGYADSMAHILSlSA 432
Cdd:cd03825  256 QLVDIYSAADLFVHPSLADNLPNTLLEAMACGTPVVAFDTGGS-PEIVQHGV---TGYLVppGDVQALAEAIEWLLA-NP 330
                        170       180
                 ....*....|....*....|
gi 568953943 433 EERLQIRKNARASISRFSDQ 452
Cdd:cd03825  331 KERESLGERARALAENHFDQ 350
PRK15484 PRK15484
lipopolysaccharide N-acetylglucosaminyltransferase;
263-443 1.31e-04

lipopolysaccharide N-acetylglucosaminyltransferase;


Pssm-ID: 185381 [Multi-domain]  Cd Length: 380  Bit Score: 44.01  E-value: 1.31e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 263 LDIPLHEKkvtpghLLVSIGQFRPEKNHALQIKAFAKLLNEKAaelghSLKLVLIGGCRNKDD----EFRvNQLRSLSEN 338
Cdd:PRK15484 187 LNISPDET------VLLYAGRISPDKGILLLMQAFEKLATAHS-----NLKLVVVGDPTASSKgekaAYQ-KKVLEAAKR 254
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 339 LGVQenVEFKINISFDELKNYLSEAT-IGLHTMWNEHFGIGVVECMAAGTVILAHNSGGpkldiviphegqITGFLAESE 417
Cdd:PRK15484 255 IGDR--CIMLGGQPPEKMHNYYPLADlVVVPSQVEEAFCMVAVEAMAAGKPVLASTKGG------------ITEFVLEGI 320
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 568953943 418 EGY-------ADSMAHILS--LSAEERLQIRKNAR 443
Cdd:PRK15484 321 TGYhlaepmtSDSIISDINrtLADPELTQIAEQAK 355
PLN02871 PLN02871
UDP-sulfoquinovose:DAG sulfoquinovosyltransferase
373-450 1.16e-03

UDP-sulfoquinovose:DAG sulfoquinovosyltransferase


Pssm-ID: 215469 [Multi-domain]  Cd Length: 465  Bit Score: 41.23  E-value: 1.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 373 EHFGIGVVECMAAGTVILAHNSGGPKlDIVIPHEGQITGFLAESEEgYADSMAHILSL--SAEERLQIRKNARASISRFS 450
Cdd:PLN02871 342 ETLGFVVLEAMASGVPVVAARAGGIP-DIIPPDQEGKTGFLYTPGD-VDDCVEKLETLlaDPELRERMGAAAREEVEKWD 419
GT4_CapH-like cd03812
capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins; This ...
269-401 1.43e-03

capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins; This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).


Pssm-ID: 340840 [Multi-domain]  Cd Length: 357  Bit Score: 40.74  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568953943 269 EKKVTPGHllvsIGQFRPEKNHALQIKAFAKLLNEkaaelGHSLKLVLIGgcrnkDDEFRvNQLRSLSENLGVQENVEF- 347
Cdd:cd03812  189 EDKLVLGH----VGRFNEQKNHSFLIDIFEELKKK-----NPNVKLVLVG-----EGELK-EKIKEKVKELGLEDKVIFl 253
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 568953943 348 --KINISfdelkNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDI 401
Cdd:cd03812  254 gfRNDVS-----EILSAMDVFLFPSLYEGLPLVAVEAQASGLPCLLSDTITKECDI 304
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH