NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|755544662|ref|XP_006516912|]
View 

sideroflexin-1 isoform X1 [Mus musculus]

Protein Classification

tricarboxylate carrier family protein (domain architecture ID 10510848)

tricarboxylate carrier family protein, such as sideroflexin, which acts as a mitochondrial transporter

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Mtc pfam03820
Tricarboxylate carrier;
10-322 0e+00

Tricarboxylate carrier;


:

Pssm-ID: 397754  Cd Length: 319  Bit Score: 555.19  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   10 NIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENELWRAKYAYDSAFHPDTGEKMTL 89
Cdd:pfam03820   1 DLDKPRWDQSTYWGRLKHFFDITDPRTLLASDAELEEAKELVDNYKKGKEPPGTTEEELWRAKKLYDSAFHPDTGEKIFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   90 IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALT 169
Cdd:pfam03820  81 PFRMSAQVPMNMPITGGMLTPYKSTPAVIFWQWVNQSFNAAVNYTNRNASSPLSTSQLGQSYVAAVTAACGVALGLNSLV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662  170 KR--VSP----LIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAI 243
Cdd:pfam03820 161 KRlkLSPatrlLLGRLVPFAAVAAANCVNIPLMRSKELRNGIDVFDEDGNVVGKSKKAAKKAVSQVALSRILMAAPGMVL 240
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755544662  244 PPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL 322
Cdd:pfam03820 241 PPLIMNRLEKTGFLKRRPWLHAPIQLGLIGLCLGFALPLACALFPQRSSISVSKLEPEFQELIKKKGGPPTTVYFNKGL 319
 
Name Accession Description Interval E-value
Mtc pfam03820
Tricarboxylate carrier;
10-322 0e+00

Tricarboxylate carrier;


Pssm-ID: 397754  Cd Length: 319  Bit Score: 555.19  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   10 NIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENELWRAKYAYDSAFHPDTGEKMTL 89
Cdd:pfam03820   1 DLDKPRWDQSTYWGRLKHFFDITDPRTLLASDAELEEAKELVDNYKKGKEPPGTTEEELWRAKKLYDSAFHPDTGEKIFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   90 IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALT 169
Cdd:pfam03820  81 PFRMSAQVPMNMPITGGMLTPYKSTPAVIFWQWVNQSFNAAVNYTNRNASSPLSTSQLGQSYVAAVTAACGVALGLNSLV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662  170 KR--VSP----LIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAI 243
Cdd:pfam03820 161 KRlkLSPatrlLLGRLVPFAAVAAANCVNIPLMRSKELRNGIDVFDEDGNVVGKSKKAAKKAVSQVALSRILMAAPGMVL 240
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755544662  244 PPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL 322
Cdd:pfam03820 241 PPLIMNRLEKTGFLKRRPWLHAPIQLGLIGLCLGFALPLACALFPQRSSISVSKLEPEFQELIKKKGGPPTTVYFNKGL 319
mtc TIGR00798
tricarboxylate carrier; The MTC family consists of a limited number of homologues, all from ...
7-322 0e+00

tricarboxylate carrier; The MTC family consists of a limited number of homologues, all from eukaryotes. A single member of the family has been functionally characterized, the tricarboxylate carrier from rat liver mitochondria. The rat liver mitochondrial tricarboxylate carrier has been reported to transport citrate, cis-aconitate, threo-D-isocitrate, D- and L-tartrate, malate, succinate and phosphoenolpyruvate. It presumably functions by a proton symport mechanism. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 129880  Cd Length: 318  Bit Score: 514.99  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662    7 PNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAgLTENELWRAKYAYDSAFHPDTGEK 86
Cdd:TIGR00798   1 PTFDISKPRWDQSTFLGRARHFFEITNPLTLFSSEKQLEKAREIVEDYKAGKASP-LTVDELWRAKKLYDSAFHPDTGEK 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   87 MTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLN 166
Cdd:TIGR00798  80 MFLPGRMSAQVPMNMVITGGMLTPYRSTPGVVFWQWINQSFNAAVNYTNRSGDSPLTLSQLLVSYCAAVTGACGVALGLN 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662  167 ALTKRV---SPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAI 243
Cdd:TIGR00798 160 MMVKKSpslSPLIGRLVPFAAVAVANAINIPMMRGNELTEGIEVFDEDGETVGKSKKAAALAIAQVVLSRVIMAVPDMVM 239
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755544662  244 PPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL 322
Cdd:TIGR00798 240 PPLIMNRLERTAWLRARPWMQIPIQTLLCGLGLAFATPLACALFPQKSAISVDKLEPSLQNLIQKLGNPPKVVYYNKGL 318
 
Name Accession Description Interval E-value
Mtc pfam03820
Tricarboxylate carrier;
10-322 0e+00

Tricarboxylate carrier;


Pssm-ID: 397754  Cd Length: 319  Bit Score: 555.19  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   10 NIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENELWRAKYAYDSAFHPDTGEKMTL 89
Cdd:pfam03820   1 DLDKPRWDQSTYWGRLKHFFDITDPRTLLASDAELEEAKELVDNYKKGKEPPGTTEEELWRAKKLYDSAFHPDTGEKIFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   90 IGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALT 169
Cdd:pfam03820  81 PFRMSAQVPMNMPITGGMLTPYKSTPAVIFWQWVNQSFNAAVNYTNRNASSPLSTSQLGQSYVAAVTAACGVALGLNSLV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662  170 KR--VSP----LIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAI 243
Cdd:pfam03820 161 KRlkLSPatrlLLGRLVPFAAVAAANCVNIPLMRSKELRNGIDVFDEDGNVVGKSKKAAKKAVSQVALSRILMAAPGMVL 240
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755544662  244 PPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL 322
Cdd:pfam03820 241 PPLIMNRLEKTGFLKRRPWLHAPIQLGLIGLCLGFALPLACALFPQRSSISVSKLEPEFQELIKKKGGPPTTVYFNKGL 319
mtc TIGR00798
tricarboxylate carrier; The MTC family consists of a limited number of homologues, all from ...
7-322 0e+00

tricarboxylate carrier; The MTC family consists of a limited number of homologues, all from eukaryotes. A single member of the family has been functionally characterized, the tricarboxylate carrier from rat liver mitochondria. The rat liver mitochondrial tricarboxylate carrier has been reported to transport citrate, cis-aconitate, threo-D-isocitrate, D- and L-tartrate, malate, succinate and phosphoenolpyruvate. It presumably functions by a proton symport mechanism. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 129880  Cd Length: 318  Bit Score: 514.99  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662    7 PNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAgLTENELWRAKYAYDSAFHPDTGEK 86
Cdd:TIGR00798   1 PTFDISKPRWDQSTFLGRARHFFEITNPLTLFSSEKQLEKAREIVEDYKAGKASP-LTVDELWRAKKLYDSAFHPDTGEK 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662   87 MTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLN 166
Cdd:TIGR00798  80 MFLPGRMSAQVPMNMVITGGMLTPYRSTPGVVFWQWINQSFNAAVNYTNRSGDSPLTLSQLLVSYCAAVTGACGVALGLN 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755544662  167 ALTKRV---SPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAI 243
Cdd:TIGR00798 160 MMVKKSpslSPLIGRLVPFAAVAVANAINIPMMRGNELTEGIEVFDEDGETVGKSKKAAALAIAQVVLSRVIMAVPDMVM 239
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755544662  244 PPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL 322
Cdd:TIGR00798 240 PPLIMNRLERTAWLRARPWMQIPIQTLLCGLGLAFATPLACALFPQKSAISVDKLEPSLQNLIQKLGNPPKVVYYNKGL 318
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH