NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568983598|ref|XP_006517427|]
View 

FAST kinase domain-containing protein 3, mitochondrial isoform X1 [Mus musculus]

Protein Classification

FAST kinase domain-containing protein (domain architecture ID 10535844)

FAST kinase domain-containing protein similar to human Fas-activated serine/threonine (FAST) kinase that phosphorylates the splicing regulator TIA1, thereby promoting the inclusion of FAS exon 6, which leads to an mRNA encoding a pro-apoptotic form of the receptor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FAST_2 pfam08368
FAST kinase-like protein, subdomain 2; This family represents a conserved region of eukaryotic ...
529-617 1.10e-30

FAST kinase-like protein, subdomain 2; This family represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases (EC:2.7.1.-) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis. Note that many family members are hypothetical proteins. This subdomain is often found associated with the FAST kinase-like protein, subdomain 2.


:

Pssm-ID: 400599  Cd Length: 87  Bit Score: 115.36  E-value: 1.10e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568983598  529 AQLTQLFLTSVLECPFYKGPKLLPKYQVKSFLTPCCSLETPLdlHLYKSVVIGLIDLLGSRLYFASKVLTPYYYTIDVEV 608
Cdd:pfam08368   1 LKLLQLNAAVKLECPEYKGPRLPEDYCVKSFKVPLSSSKKKS--PLQKEVLEALKELLGGENYVKSNVLTPYGYTIDFEC 78

                  ....*....
gi 568983598  609 KLDEDGFVL 617
Cdd:pfam08368  79 HLDKDGKPL 87
FAST_1 pfam06743
FAST kinase-like protein, subdomain 1; This family represents a conserved region of eukaryotic ...
447-515 7.68e-21

FAST kinase-like protein, subdomain 1; This family represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases (EC:2.7.1.-) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis. Note that many family members are hypothetical proteins. This region is often found immediately N-terminal to the FAST kinase-like protein, subdomain 2.


:

Pssm-ID: 399608  Cd Length: 69  Bit Score: 86.39  E-value: 7.68e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568983598  447 AELIEPFGKLNYVPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQR 515
Cdd:pfam06743   1 SSILLPFARLNYLPPNAEEFFEKLESVLEPYLSSFSPEDLLDLVWSLCVLGRFPEALLNKVLSPDFLQK 69
RAP smart00952
This domain is found in various eukaryotic species, particularly in apicomplexans; In ...
631-688 1.04e-17

This domain is found in various eukaryotic species, particularly in apicomplexans; In Plasmodium falciparum, the domain is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain.


:

Pssm-ID: 214932  Cd Length: 58  Bit Score: 77.27  E-value: 1.04e-17
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 568983598   631 LCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRK 688
Cdd:smart00952   1 IEVDGPSHFCRNSRHLLGRLALKKRHLEALGYKVISIPYYEWNKLKSEDEKVEYLKEK 58
 
Name Accession Description Interval E-value
FAST_2 pfam08368
FAST kinase-like protein, subdomain 2; This family represents a conserved region of eukaryotic ...
529-617 1.10e-30

FAST kinase-like protein, subdomain 2; This family represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases (EC:2.7.1.-) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis. Note that many family members are hypothetical proteins. This subdomain is often found associated with the FAST kinase-like protein, subdomain 2.


Pssm-ID: 400599  Cd Length: 87  Bit Score: 115.36  E-value: 1.10e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568983598  529 AQLTQLFLTSVLECPFYKGPKLLPKYQVKSFLTPCCSLETPLdlHLYKSVVIGLIDLLGSRLYFASKVLTPYYYTIDVEV 608
Cdd:pfam08368   1 LKLLQLNAAVKLECPEYKGPRLPEDYCVKSFKVPLSSSKKKS--PLQKEVLEALKELLGGENYVKSNVLTPYGYTIDFEC 78

                  ....*....
gi 568983598  609 KLDEDGFVL 617
Cdd:pfam08368  79 HLDKDGKPL 87
FAST_1 pfam06743
FAST kinase-like protein, subdomain 1; This family represents a conserved region of eukaryotic ...
447-515 7.68e-21

FAST kinase-like protein, subdomain 1; This family represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases (EC:2.7.1.-) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis. Note that many family members are hypothetical proteins. This region is often found immediately N-terminal to the FAST kinase-like protein, subdomain 2.


Pssm-ID: 399608  Cd Length: 69  Bit Score: 86.39  E-value: 7.68e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568983598  447 AELIEPFGKLNYVPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQR 515
Cdd:pfam06743   1 SSILLPFARLNYLPPNAEEFFEKLESVLEPYLSSFSPEDLLDLVWSLCVLGRFPEALLNKVLSPDFLQK 69
RAP smart00952
This domain is found in various eukaryotic species, particularly in apicomplexans; In ...
631-688 1.04e-17

This domain is found in various eukaryotic species, particularly in apicomplexans; In Plasmodium falciparum, the domain is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain.


Pssm-ID: 214932  Cd Length: 58  Bit Score: 77.27  E-value: 1.04e-17
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 568983598   631 LCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRK 688
Cdd:smart00952   1 IEVDGPSHFCRNSRHLLGRLALKKRHLEALGYKVISIPYYEWNKLKSEDEKVEYLKEK 58
RAP pfam08373
RAP domain; This domain is found in various eukaryotic species, where it is found in proteins ...
631-688 1.23e-15

RAP domain; This domain is found in various eukaryotic species, where it is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain. The domain is involved in plant defense in response to bacterial infection.


Pssm-ID: 400602  Cd Length: 58  Bit Score: 71.46  E-value: 1.23e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 568983598  631 LCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRK 688
Cdd:pfam08373   1 IEVDGPSHFYRNSKQLTGSTKLKHRLLSALGYKVIHIPYYEWNQLKTKEEKVEYLKKK 58
 
Name Accession Description Interval E-value
FAST_2 pfam08368
FAST kinase-like protein, subdomain 2; This family represents a conserved region of eukaryotic ...
529-617 1.10e-30

FAST kinase-like protein, subdomain 2; This family represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases (EC:2.7.1.-) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis. Note that many family members are hypothetical proteins. This subdomain is often found associated with the FAST kinase-like protein, subdomain 2.


Pssm-ID: 400599  Cd Length: 87  Bit Score: 115.36  E-value: 1.10e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568983598  529 AQLTQLFLTSVLECPFYKGPKLLPKYQVKSFLTPCCSLETPLdlHLYKSVVIGLIDLLGSRLYFASKVLTPYYYTIDVEV 608
Cdd:pfam08368   1 LKLLQLNAAVKLECPEYKGPRLPEDYCVKSFKVPLSSSKKKS--PLQKEVLEALKELLGGENYVKSNVLTPYGYTIDFEC 78

                  ....*....
gi 568983598  609 KLDEDGFVL 617
Cdd:pfam08368  79 HLDKDGKPL 87
FAST_1 pfam06743
FAST kinase-like protein, subdomain 1; This family represents a conserved region of eukaryotic ...
447-515 7.68e-21

FAST kinase-like protein, subdomain 1; This family represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases (EC:2.7.1.-) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis. Note that many family members are hypothetical proteins. This region is often found immediately N-terminal to the FAST kinase-like protein, subdomain 2.


Pssm-ID: 399608  Cd Length: 69  Bit Score: 86.39  E-value: 7.68e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568983598  447 AELIEPFGKLNYVPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQR 515
Cdd:pfam06743   1 SSILLPFARLNYLPPNAEEFFEKLESVLEPYLSSFSPEDLLDLVWSLCVLGRFPEALLNKVLSPDFLQK 69
RAP smart00952
This domain is found in various eukaryotic species, particularly in apicomplexans; In ...
631-688 1.04e-17

This domain is found in various eukaryotic species, particularly in apicomplexans; In Plasmodium falciparum, the domain is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain.


Pssm-ID: 214932  Cd Length: 58  Bit Score: 77.27  E-value: 1.04e-17
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 568983598   631 LCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRK 688
Cdd:smart00952   1 IEVDGPSHFCRNSRHLLGRLALKKRHLEALGYKVISIPYYEWNKLKSEDEKVEYLKEK 58
RAP pfam08373
RAP domain; This domain is found in various eukaryotic species, where it is found in proteins ...
631-688 1.23e-15

RAP domain; This domain is found in various eukaryotic species, where it is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain. The domain is involved in plant defense in response to bacterial infection.


Pssm-ID: 400602  Cd Length: 58  Bit Score: 71.46  E-value: 1.23e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 568983598  631 LCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRK 688
Cdd:pfam08373   1 IEVDGPSHFYRNSKQLTGSTKLKHRLLSALGYKVIHIPYYEWNQLKTKEEKVEYLKKK 58
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH