NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|569002910|ref|XP_006525535|]
View 

synaptopodin isoform X2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03247 super family cl33720
large tegument protein UL36; Provisional
739-1059 7.06e-09

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 60.34  E-value: 7.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  739 PSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYALSPvkePAKASSRAT 818
Cdd:PHA03247 2712 PHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGP---PRRLTRPAV 2788
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  819 SSRTPSRTVSPRAASPAKPssldlvpnlPRAGLPPSPALPRPSRSSPGLYTAPvqdslqptadrpESLPTSPPWTPAASR 898
Cdd:PHA03247 2789 ASLSESRESLPSPWDPADP---------PAAVLAPAAALPPAASPAGPLPPPT------------SAQPTAPPPPPGPPP 2847
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  899 PPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQlqallarniinaARRKSASPRP 978
Cdd:PHA03247 2848 PSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQP------------ERPPQPQAPP 2915
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  979 APAETLRPFSPPQGPPPPPARMRSPQPASPARNFRGAAfSPIPRSPLP----IGPSSCASPRS--PQAAPSRPFPYRRSP 1052
Cdd:PHA03247 2916 PPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAG-EPSGAVPQPwlgaLVPGRVAVPRFrvPQPAPSREAPASSTP 2994

                  ....*..
gi 569002910 1053 TDSDVSL 1059
Cdd:PHA03247 2995 PLTGHSL 3001
PRK13914 super family cl36314
invasion associated endopeptidase;
254-371 2.57e-06

invasion associated endopeptidase;


The actual alignment was detected with superfamily member PRK13914:

Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 51.34  E-value: 2.57e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  254 EKVASEEEEVPLVvylKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTA 333
Cdd:PRK13914  259 EAPAAEKQAAPVV---KENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTSTPSK 335
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 569002910  334 DINQNPPAAITPVPqNSSQAQCSPNGTLDSKPGTLCAD 371
Cdd:PRK13914  336 NTNTNTNSNTNTNS-NTNANQGSSNNNSNSSASAIIAE 372
PHA03247 super family cl33720
large tegument protein UL36; Provisional
291-583 1.20e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.47  E-value: 1.20e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  291 QSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGtlca 370
Cdd:PHA03247 2730 QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPA---- 2805
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  371 dDGQSPVPAeevRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPghvAVTTP 450
Cdd:PHA03247 2806 -DPPAAVLA---PAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAA---KPAAP 2878
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  451 TKVYSEvhlTLAKPAsvVNRTARPFGIQSPGTSQIEQSPMMGRRQfgEKAWAPPASSMADRSPQPQRHIMSRSPMVERRL 530
Cdd:PHA03247 2879 ARPPVR---RLARPA--VSRSTESFALPPDQPERPPQPQAPPPPQ--PQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 569002910  531 LGQRSPVLERRPLGNFTPPPTYA-ETLSTAPVASRVRSPPSYSTLYPSSDPKPS 583
Cdd:PHA03247 2952 AGEPSGAVPQPWLGALVPGRVAVpRFRVPQPAPSREAPASSTPPLTGHSLSRVS 3005
PTZ00449 super family cl33186
104 kDa microneme/rhoptry antigen; Provisional
51-367 9.68e-03

104 kDa microneme/rhoptry antigen; Provisional


The actual alignment was detected with superfamily member PTZ00449:

Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.06  E-value: 9.68e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910   51 RLVDLEEEGTSQsranHGTPPLS--------RAPAIIQPSSCHREARGGFQRSD---RPSHDWDVVQARKVMTA-SGSSS 118
Cdd:PTZ00449  495 KLAPIEEEDSDK----HDEPPEGpeasglppKAPGDKEGEEGEHEDSKESDEPKeggKPGETKEGEVGKKPGPAkEHKPS 570
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  119 PVPRVAQKPAlGRSTSFTENDLKEAKARSQQIAAQLTTPPSSNSRgvqlfnrrrqrvneftlesrgQRSPKLNQEALQTG 198
Cdd:PTZ00449  571 KIPTLSKKPE-FPKDPKHPKDPEEPKKPKRPRSAQRPTRPKSPKL---------------------PELLDIPKSPKRPE 628
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  199 RPLSPigHAPGPSVKPTSPSKPGSPKHP----SPQSPSRGVAGHIME----GYSEEASLLRH--LEKVASEEEEVPLVVY 268
Cdd:PTZ00449  629 SPKSP--KRPPPPQRPSSPERPEGPKIIkspkPPKSPKPPFDPKFKEkfydDYLDAAAKSKEtkTTVVLDESFESILKET 706
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  269 LKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLT----TLASSSHHSQPTADINQNPPAAIT 344
Cdd:PTZ00449  707 LPETPGTPFTTPRPLPPKLPRDEEFPFEPIGDPDAEQPDDIEFFTPPEEERTffheTPADTPLPDILAEEFKEEDIHAET 786
                         330       340
                  ....*....|....*....|...
gi 569002910  345 PVPQNSSQAQCSPNGTLDSKPGT 367
Cdd:PTZ00449  787 GEPDEAMKRPDSPSEHEDKPPGD 809
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
739-1059 7.06e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 60.34  E-value: 7.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  739 PSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYALSPvkePAKASSRAT 818
Cdd:PHA03247 2712 PHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGP---PRRLTRPAV 2788
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  819 SSRTPSRTVSPRAASPAKPssldlvpnlPRAGLPPSPALPRPSRSSPGLYTAPvqdslqptadrpESLPTSPPWTPAASR 898
Cdd:PHA03247 2789 ASLSESRESLPSPWDPADP---------PAAVLAPAAALPPAASPAGPLPPPT------------SAQPTAPPPPPGPPP 2847
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  899 PPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQlqallarniinaARRKSASPRP 978
Cdd:PHA03247 2848 PSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQP------------ERPPQPQAPP 2915
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  979 APAETLRPFSPPQGPPPPPARMRSPQPASPARNFRGAAfSPIPRSPLP----IGPSSCASPRS--PQAAPSRPFPYRRSP 1052
Cdd:PHA03247 2916 PPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAG-EPSGAVPQPwlgaLVPGRVAVPRFrvPQPAPSREAPASSTP 2994

                  ....*..
gi 569002910 1053 TDSDVSL 1059
Cdd:PHA03247 2995 PLTGHSL 3001
PRK13914 PRK13914
invasion associated endopeptidase;
254-371 2.57e-06

invasion associated endopeptidase;


Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 51.34  E-value: 2.57e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  254 EKVASEEEEVPLVvylKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTA 333
Cdd:PRK13914  259 EAPAAEKQAAPVV---KENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTSTPSK 335
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 569002910  334 DINQNPPAAITPVPqNSSQAQCSPNGTLDSKPGTLCAD 371
Cdd:PRK13914  336 NTNTNTNSNTNTNS-NTNANQGSSNNNSNSSASAIIAE 372
PHA03247 PHA03247
large tegument protein UL36; Provisional
291-583 1.20e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.47  E-value: 1.20e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  291 QSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGtlca 370
Cdd:PHA03247 2730 QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPA---- 2805
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  371 dDGQSPVPAeevRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPghvAVTTP 450
Cdd:PHA03247 2806 -DPPAAVLA---PAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAA---KPAAP 2878
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  451 TKVYSEvhlTLAKPAsvVNRTARPFGIQSPGTSQIEQSPMMGRRQfgEKAWAPPASSMADRSPQPQRHIMSRSPMVERRL 530
Cdd:PHA03247 2879 ARPPVR---RLARPA--VSRSTESFALPPDQPERPPQPQAPPPPQ--PQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 569002910  531 LGQRSPVLERRPLGNFTPPPTYA-ETLSTAPVASRVRSPPSYSTLYPSSDPKPS 583
Cdd:PHA03247 2952 AGEPSGAVPQPWLGALVPGRVAVpRFRVPQPAPSREAPASSTPPLTGHSLSRVS 3005
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
51-367 9.68e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.06  E-value: 9.68e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910   51 RLVDLEEEGTSQsranHGTPPLS--------RAPAIIQPSSCHREARGGFQRSD---RPSHDWDVVQARKVMTA-SGSSS 118
Cdd:PTZ00449  495 KLAPIEEEDSDK----HDEPPEGpeasglppKAPGDKEGEEGEHEDSKESDEPKeggKPGETKEGEVGKKPGPAkEHKPS 570
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  119 PVPRVAQKPAlGRSTSFTENDLKEAKARSQQIAAQLTTPPSSNSRgvqlfnrrrqrvneftlesrgQRSPKLNQEALQTG 198
Cdd:PTZ00449  571 KIPTLSKKPE-FPKDPKHPKDPEEPKKPKRPRSAQRPTRPKSPKL---------------------PELLDIPKSPKRPE 628
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  199 RPLSPigHAPGPSVKPTSPSKPGSPKHP----SPQSPSRGVAGHIME----GYSEEASLLRH--LEKVASEEEEVPLVVY 268
Cdd:PTZ00449  629 SPKSP--KRPPPPQRPSSPERPEGPKIIkspkPPKSPKPPFDPKFKEkfydDYLDAAAKSKEtkTTVVLDESFESILKET 706
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  269 LKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLT----TLASSSHHSQPTADINQNPPAAIT 344
Cdd:PTZ00449  707 LPETPGTPFTTPRPLPPKLPRDEEFPFEPIGDPDAEQPDDIEFFTPPEEERTffheTPADTPLPDILAEEFKEEDIHAET 786
                         330       340
                  ....*....|....*....|...
gi 569002910  345 PVPQNSSQAQCSPNGTLDSKPGT 367
Cdd:PTZ00449  787 GEPDEAMKRPDSPSEHEDKPPGD 809
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
739-1059 7.06e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 60.34  E-value: 7.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  739 PSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYALSPvkePAKASSRAT 818
Cdd:PHA03247 2712 PHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGP---PRRLTRPAV 2788
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  819 SSRTPSRTVSPRAASPAKPssldlvpnlPRAGLPPSPALPRPSRSSPGLYTAPvqdslqptadrpESLPTSPPWTPAASR 898
Cdd:PHA03247 2789 ASLSESRESLPSPWDPADP---------PAAVLAPAAALPPAASPAGPLPPPT------------SAQPTAPPPPPGPPP 2847
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  899 PPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQlqallarniinaARRKSASPRP 978
Cdd:PHA03247 2848 PSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQP------------ERPPQPQAPP 2915
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  979 APAETLRPFSPPQGPPPPPARMRSPQPASPARNFRGAAfSPIPRSPLP----IGPSSCASPRS--PQAAPSRPFPYRRSP 1052
Cdd:PHA03247 2916 PPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAG-EPSGAVPQPwlgaLVPGRVAVPRFrvPQPAPSREAPASSTP 2994

                  ....*..
gi 569002910 1053 TDSDVSL 1059
Cdd:PHA03247 2995 PLTGHSL 3001
PRK13914 PRK13914
invasion associated endopeptidase;
254-371 2.57e-06

invasion associated endopeptidase;


Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 51.34  E-value: 2.57e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  254 EKVASEEEEVPLVvylKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTA 333
Cdd:PRK13914  259 EAPAAEKQAAPVV---KENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTSTPSK 335
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 569002910  334 DINQNPPAAITPVPqNSSQAQCSPNGTLDSKPGTLCAD 371
Cdd:PRK13914  336 NTNTNTNSNTNTNS-NTNANQGSSNNNSNSSASAIIAE 372
PHA03247 PHA03247
large tegument protein UL36; Provisional
794-1047 2.56e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 48.78  E-value: 2.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  794 PYQMRPSLYALSPVKEPAKASsRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSrsSPGLYTAPVQ 873
Cdd:PHA03247 2512 PSRLAPAILPDEPVGEPVHPR-MLTWIRGLEELASDDAGDPPPPLPPAAPPAAPDRSVPPPRPAPRPS--EPAVTSRARR 2588
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  874 DSLQPTADRPESlPTSPPWTPAASRPPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPP 953
Cdd:PHA03247 2589 PDAPPQSARPRA-PVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRA 2667
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  954 SRQLQALLARNIINAARRKSASPRPAPAETLRPFSPPQGPPPPPARMRSPQ-PASPARNFRGAAFSPIPRSPL-PIGPSS 1031
Cdd:PHA03247 2668 RRLGRAAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSAtPLPPGPAAARQASPALPAAPApPAVPAG 2747
                         250
                  ....*....|....*.
gi 569002910 1032 CASPRSPQAAPSRPFP 1047
Cdd:PHA03247 2748 PATPGGPARPARPPTT 2763
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
753-945 7.02e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 46.79  E-value: 7.02e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  753 TNAPGGFRVASLSPARTPPASLyhGYLPENGVLRPEPTKQQPYQMRPSLYALSPVKEPAKASSRATSSRTPSRTVSPRAA 832
Cdd:PRK12323  384 QPAPAAAAPAAAAPAPAAPPAA--PAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPAPAAAPAAA 461
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  833 SPakpssldlvPNLPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTADRPESLPTSPPWTPAASRPPSSLDGWVSPGPW 912
Cdd:PRK12323  462 AR---------PAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPATA 532
                         170       180       190
                  ....*....|....*....|....*....|...
gi 569002910  913 EPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLR 945
Cdd:PRK12323  533 DPDDAFETLAPAPAAAPAPRAAAATEPVVAPRP 565
PHA03247 PHA03247
large tegument protein UL36; Provisional
291-583 1.20e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.47  E-value: 1.20e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  291 QSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGtlca 370
Cdd:PHA03247 2730 QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPA---- 2805
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  371 dDGQSPVPAeevRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPghvAVTTP 450
Cdd:PHA03247 2806 -DPPAAVLA---PAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAA---KPAAP 2878
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  451 TKVYSEvhlTLAKPAsvVNRTARPFGIQSPGTSQIEQSPMMGRRQfgEKAWAPPASSMADRSPQPQRHIMSRSPMVERRL 530
Cdd:PHA03247 2879 ARPPVR---RLARPA--VSRSTESFALPPDQPERPPQPQAPPPPQ--PQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 569002910  531 LGQRSPVLERRPLGNFTPPPTYA-ETLSTAPVASRVRSPPSYSTLYPSSDPKPS 583
Cdd:PHA03247 2952 AGEPSGAVPQPWLGALVPGRVAVpRFRVPQPAPSREAPASSTPPLTGHSLSRVS 3005
PHA03247 PHA03247
large tegument protein UL36; Provisional
766-1048 1.66e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.66e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  766 PARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYAlSPVKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPN 845
Cdd:PHA03247 2556 PPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPP-QSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPA 2634
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  846 LPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTADRPESLPTSPP--WTPAASRPP-SSLDGWVSPGPwePGRGSSMSS 922
Cdd:PHA03247 2635 ANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPqrPRRRAARPTvGSLTSLADPPP--PPPTPEPAP 2712
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  923 PPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQLQAL------LARNIINAARRKSASPRPAPAETLRPFSPPQGPPPP 996
Cdd:PHA03247 2713 HALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATpggparPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLS 2792
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 569002910  997 PARMRSPQPASPAR-----NFRGAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFPY 1048
Cdd:PHA03247 2793 ESRESLPSPWDPADppaavLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPS 2849
dnaA PRK14086
chromosomal replication initiator protein DnaA;
820-914 2.60e-04

chromosomal replication initiator protein DnaA;


Pssm-ID: 237605 [Multi-domain]  Cd Length: 617  Bit Score: 44.82  E-value: 2.60e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  820 SRTPSRTVSP--RAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTADRPESLPTSPPWTPAAS 897
Cdd:PRK14086   71 SETLSRELGRpiRIAITVDPSAGEPAPPPPHARRTSEPELPRPGRRPYEGYGGPRADDRPPGLPRQDQLPTARPAYPAYQ 150
                          90
                  ....*....|....*..
gi 569002910  898 RPPssldgwvSPGPWEP 914
Cdd:PRK14086  151 QRP-------EPGAWPR 160
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
725-1063 4.85e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 44.07  E-value: 4.85e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  725 YVIESSGHAELARCPSP----TMSLPSSWKYTTNAPGGFRVASLSPARTPPAslyhgyLPENGVLRPEPTKQQPYQMRPS 800
Cdd:PRK07003  328 YQIATVGRGELGLAPDEyagfTMTLLRMLAFEPAVTGGGAPGGGVPARVAGA------VPAPGARAAAAVGASAVPAVTA 401
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  801 lyalSPVKEPAKASSRATSSRTPSRTVSPrAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPglytAPVQDSLQPTA 880
Cdd:PRK07003  402 ----VTGAAGAALAPKAAAAAAATRAEAP-PAAPAPPATADRGDDAADGDAPVPAKANARASADS----RCDERDAQPPA 472
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  881 DRPESLPTSPPWTPAASRPPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPlrSETEARPPSRQLQAL 960
Cdd:PRK07003  473 DSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAAASREDAPAAAAPPAPEARPP--TPAAAAPAARAGGAA 550
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  961 LARNIINAARRKSASPRPAPAetlrpfspPQGPPPPPARMRSPQPASParnfRGAAFSPIPRSPLPIGPSSCA-SPRSPQ 1039
Cdd:PRK07003  551 AALDVLRNAGMRVSSDRGARA--------AAAAKPAAAPAAAPKPAAP----RVAVQVPTPRARAATGDAPPNgAARAEQ 618
                         330       340
                  ....*....|....*....|....*.
gi 569002910 1040 AAPSR--PFPYRRSPTDSDVSLDSED 1063
Cdd:PRK07003  619 AAESRgaPPPWEDIPPDDYVPLSADE 644
PHA03247 PHA03247
large tegument protein UL36; Provisional
502-1023 1.47e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 43.00  E-value: 1.47e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  502 APPASsmADRS-PQPQRHIMSRSPMV---ERRLLGQRSPVLERRPLGNFTPPPTYAETLSTAPVASRVRSPPSYSTLYPS 577
Cdd:PHA03247 2559 APPAA--PDRSvPPPRPAPRPSEPAVtsrARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAAN 2636
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  578 SDPKPSHLKG--QVAPANKTGILEESMARRGSRKSMFTFVEKPKVTPNP--------DLLDLVQTADEKRRQRDHGEVGM 647
Cdd:PHA03247 2637 EPDPHPPPTVppPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRraarptvgSLTSLADPPPPPPTPEPAPHALV 2716
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  648 EEEPFALGAEASNFQQEPIARDRASPAAAE-EAVPEWASCLKSPRIQAKPkPKPNQNLSEASGKgaelyARRQSRMEKyv 726
Cdd:PHA03247 2717 SATPLPPGPAAARQASPALPAAPAPPAVPAgPATPGGPARPARPPTTAGP-PAPAPPAAPAAGP-----PRRLTRPAV-- 2788
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  727 ieSSGHAELARCPSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLyhgyLPENGVLRPEPTkQQPYQMRPSLYALSP 806
Cdd:PHA03247 2789 --ASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSA----QPTAPPPPPGPP-PPSLPLGGSVAPGGD 2861
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  807 VKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPnLPRAGL--PPSPALPRPSRSSPGLYTAPVQDSLQPTADRPE 884
Cdd:PHA03247 2862 VRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFA-LPPDQPerPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQ 2940
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  885 SLPTSPPWTPAASRP----PSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRS--------ETEARP 952
Cdd:PHA03247 2941 PPLAPTTDPAGAGEPsgavPQPWLGALVPGRVAVPRFRVPQPAPSREAPASSTPPLTGHSLSRVSSwasslalhEETDPP 3020
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  953 PSRQLQALLARN-----------IINAARRKSASPRPAPAETLRPFSPPQGppppparmrSPQPASPARNFRGAAFSPIP 1021
Cdd:PHA03247 3021 PVSLKQTLWPPDdtedsdadslfDSDSERSDLEALDPLPPEPHDPFAHEPD---------PATPEAGARESPSSQFGPPP 3091

                  ..
gi 569002910 1022 RS 1023
Cdd:PHA03247 3092 LS 3093
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
788-902 1.73e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 42.37  E-value: 1.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  788 EPTKQQPYQMRPSLYALSPVKEPAKASSRATSSRTPSRTVSPRaaSPAKPSSLDLVPNLPRAGLPPSPALPRPSrsspgl 867
Cdd:PTZ00449  568 KPSKIPTLSKKPEFPKDPKHPKDPEEPKKPKRPRSAQRPTRPK--SPKLPELLDIPKSPKRPESPKSPKRPPPP------ 639
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 569002910  868 yTAPVqdslqpTADRPESlptspPWTPAASRPPSS 902
Cdd:PTZ00449  640 -QRPS------SPERPEG-----PKIIKSPKPPKS 662
PHA03247 PHA03247
large tegument protein UL36; Provisional
205-871 2.92e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.85  E-value: 2.92e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  205 GHAPGP-SVKPTSPSKPGSPKHPSPQSPSRGVAGHIMegYSEEASLLRHLEKVASEE--EEVPLVVYLKENAALltangl 281
Cdd:PHA03247 2493 GAAPDPgGGGPPDPDAPPAPSRLAPAILPDEPVGEPV--HPRMLTWIRGLEELASDDagDPPPPLPPAAPPAAP------ 2564
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  282 hlSQSRETQQSSPNPPDTEVPSPAA--DINQNPSSPNATLTTLASSSHHSQPTAdinqNPPAAITPVPQNSSQaqcSPNG 359
Cdd:PHA03247 2565 --DRSVPPPRPAPRPSEPAVTSRARrpDAPPQSARPRAPVDDRGDPRGPAPPSP----LPPDTHAPDPPPPSP---SPAA 2635
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  360 TLDSKPGTLCADDGQSPVPAEEVRSsILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQ 439
Cdd:PHA03247 2636 NEPDPHPPPTVPPPERPRDDPAPGR-VSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHA 2714
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  440 EVPGHVAVTTPTKVYSEVHLTLAKPA--SVVNRTARPFGIQSPGTSQIEQSPmmgrrqfgeKAWAPPASSMADRSPQPQR 517
Cdd:PHA03247 2715 LVSATPLPPGPAAARQASPALPAAPAppAVPAGPATPGGPARPARPPTTAGP---------PAPAPPAAPAAGPPRRLTR 2785
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  518 HIMSRSPMVERRLLGQRSPVLERRPLgnftPPPTYAETLSTAPvASRVRSPPSYSTLYPSSDPKPSH----LKGQVAPAN 593
Cdd:PHA03247 2786 PAVASLSESRESLPSPWDPADPPAAV----LAPAAALPPAASP-AGPLPPPTSAQPTAPPPPPGPPPpslpLGGSVAPGG 2860
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  594 ktgileeSMARRGSRKSMftfVEKPKVTPNPDLLDLVQTAdekrrqrdhgeVGMEEEPFALGAEASNFQQEPIARDRASP 673
Cdd:PHA03247 2861 -------DVRRRPPSRSP---AAKPAAPARPPVRRLARPA-----------VSRSTESFALPPDQPERPPQPQAPPPPQP 2919
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  674 AAAEEAVPEWASCLKSP-RIQAKPKPKPN-QNLSEASGKGAELYarrqsrmekyviesSGHAELARCPSPTMSLPSswky 751
Cdd:PHA03247 2920 QPQPPPPPQPQPPPPPPpRPQPPLAPTTDpAGAGEPSGAVPQPW--------------LGALVPGRVAVPRFRVPQ---- 2981
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  752 ttNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTkQQPYQMRPSLYALSPVKEpakassratSSRTPSRTVSPRA 831
Cdd:PHA03247 2982 --PAPSREAPASSTPPLTGHSLSRVSSWASSLALHEETD-PPPVSLKQTLWPPDDTED---------SDADSLFDSDSER 3049
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|
gi 569002910  832 ASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAP 871
Cdd:PHA03247 3050 SDLEALDPLPPEPHDPFAHEPDPATPEAGARESPSSQFGP 3089
PRK11907 PRK11907
bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase;
274-365 4.23e-03

bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase;


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 40.99  E-value: 4.23e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  274 ALLTANGLHLSQSRETQQSSPNPP-----DTEVPSPAADINQNPSSPNATLTtlaSSSHHSQPTADINQNPPAAITPVpQ 348
Cdd:PRK11907   16 ALLTASNPKLAQAEEIVTTTPATSteaeqTTPVESDATEEADNTETPVAATT---AAEAPSSSETAETSDPTSEATDT-T 91
                          90
                  ....*....|....*..
gi 569002910  349 NSSQAQCSPNGTLDSKP 365
Cdd:PRK11907   92 TSEARTVTPAATETSKP 108
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
810-1010 8.70e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 40.24  E-value: 8.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  810 PAKASSRATSSRTPsRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLytAPVQDSLQPTADRPESLPTS 889
Cdd:PRK12323  374 PATAAAAPVAQPAP-AAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAP--EALAAARQASARGPGGAPAP 450
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  890 PPwTPAASRPPSsldgwVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRS--ETEARPPSRQLQALLARNIIN 967
Cdd:PRK12323  451 AP-APAAAPAAA-----ARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEElpPEFASPAPAQPDAAPAGWVAE 524
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 569002910  968 AARRKSASPRPAPAETLRPFSPPQGPPPPPARMRSPQPASPAR 1010
Cdd:PRK12323  525 SIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPR 567
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
51-367 9.68e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.06  E-value: 9.68e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910   51 RLVDLEEEGTSQsranHGTPPLS--------RAPAIIQPSSCHREARGGFQRSD---RPSHDWDVVQARKVMTA-SGSSS 118
Cdd:PTZ00449  495 KLAPIEEEDSDK----HDEPPEGpeasglppKAPGDKEGEEGEHEDSKESDEPKeggKPGETKEGEVGKKPGPAkEHKPS 570
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  119 PVPRVAQKPAlGRSTSFTENDLKEAKARSQQIAAQLTTPPSSNSRgvqlfnrrrqrvneftlesrgQRSPKLNQEALQTG 198
Cdd:PTZ00449  571 KIPTLSKKPE-FPKDPKHPKDPEEPKKPKRPRSAQRPTRPKSPKL---------------------PELLDIPKSPKRPE 628
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  199 RPLSPigHAPGPSVKPTSPSKPGSPKHP----SPQSPSRGVAGHIME----GYSEEASLLRH--LEKVASEEEEVPLVVY 268
Cdd:PTZ00449  629 SPKSP--KRPPPPQRPSSPERPEGPKIIkspkPPKSPKPPFDPKFKEkfydDYLDAAAKSKEtkTTVVLDESFESILKET 706
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569002910  269 LKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLT----TLASSSHHSQPTADINQNPPAAIT 344
Cdd:PTZ00449  707 LPETPGTPFTTPRPLPPKLPRDEEFPFEPIGDPDAEQPDDIEFFTPPEEERTffheTPADTPLPDILAEEFKEEDIHAET 786
                         330       340
                  ....*....|....*....|...
gi 569002910  345 PVPQNSSQAQCSPNGTLDSKPGT 367
Cdd:PTZ00449  787 GEPDEAMKRPDSPSEHEDKPPGD 809
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH