NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|569006892|ref|XP_006526980|]
View 

very low-density lipoprotein receptor isoform X1 [Mus musculus]

Protein Classification

LDLa and Ldl_recept_b domain-containing protein (domain architecture ID 10819527)

protein containing domains LDLa, FXa_inhibition, LY, and Ldl_recept_b

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
568-608 1.70e-15

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


:

Pssm-ID: 395012  Cd Length: 41  Bit Score: 70.66  E-value: 1.70e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 569006892  568 GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLD 608
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
237-273 5.23e-12

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 60.73  E-value: 5.23e-12
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 569006892  237 TKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
33-67 2.52e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


:

Pssm-ID: 238060  Cd Length: 35  Bit Score: 58.76  E-value: 2.52e-11
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892  33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
276-312 5.40e-11

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 58.03  E-value: 5.40e-11
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 569006892  276 RTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
153-188 1.41e-10

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 56.87  E-value: 1.41e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892  153 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 188
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
71-103 4.39e-10

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


:

Pssm-ID: 197566  Cd Length: 33  Bit Score: 55.33  E-value: 4.39e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892    71 TCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
508-547 5.18e-10

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


:

Pssm-ID: 214531  Cd Length: 43  Bit Score: 55.30  E-value: 5.18e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 569006892   508 MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKR 547
Cdd:smart00135   4 LSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
592-634 3.39e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


:

Pssm-ID: 214531  Cd Length: 43  Bit Score: 52.99  E-value: 3.39e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 569006892   592 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDR 634
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
192-224 3.73e-09

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 52.64  E-value: 3.73e-09
                          10        20        30
                  ....*....|....*....|....*....|...
gi 569006892  192 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
111-149 4.03e-09

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 52.64  E-value: 4.03e-09
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 569006892  111 RTCRINEISCGarSTQCIPVSWRCDGENDCDNGEDEENC 149
Cdd:pfam00057   1 STCSPNEFQCG--SGECIPRSWVCDGDPDCGDGSDEENC 37
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
320-350 1.06e-07

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 48.40  E-value: 1.06e-07
                          10        20        30
                  ....*....|....*....|....*....|.
gi 569006892  320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:pfam00057   4 SPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
481-521 3.13e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


:

Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.13e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 569006892  481 QKLFWADLSQKA-IFSASIDDKVgRHFKMIDNVYNPAAIAVD 521
Cdd:pfam00058   1 GRLYWTDSSLRAsISSADLNGSD-RKTLLSEDLQHPNGIAVD 41
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
360-394 4.39e-07

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


:

Pssm-ID: 405372  Cd Length: 36  Bit Score: 46.84  E-value: 4.39e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892  360 CLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTC 394
Cdd:pfam14670   1 CSVNNGGCSHLCLNTPGGYTCSCPEGYKLQeDGRTC 36
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
655-694 4.63e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


:

Pssm-ID: 395012  Cd Length: 41  Bit Score: 46.78  E-value: 4.63e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 569006892  655 DRVYWIDGENEAVYGANKFTGSELATLV-NNLNDAQDIIVY 694
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLsEDLQHPNGIAVD 41
EGF_CA smart00179
Calcium-binding EGF-like domain;
396-426 7.07e-06

Calcium-binding EGF-like domain;


:

Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.39  E-value: 7.07e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   396 DIDECQNPGICSQ--ICINLKGGYKCECSRGYQ 426
Cdd:smart00179   1 DIDECASGNPCQNggTCVNTVGSYRCECPPGYT 33
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
706-749 5.01e-05

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


:

Pssm-ID: 405372  Cd Length: 36  Bit Score: 41.07  E-value: 5.01e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 569006892  706 CEDDmeNGGCEYLCLPAPQindhspKYTCSCPNGYNLEENGREC 749
Cdd:pfam14670   1 CSVN--NGGCSHLCLNTPG------GYTCSCPEGYKLQEDGRTC 36
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
461-499 9.61e-03

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


:

Pssm-ID: 214531  Cd Length: 43  Bit Score: 34.88  E-value: 9.61e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 569006892   461 YIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 499
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLD 39
 
Name Accession Description Interval E-value
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
568-608 1.70e-15

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 70.66  E-value: 1.70e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 569006892  568 GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLD 608
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
237-273 5.23e-12

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 60.73  E-value: 5.23e-12
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 569006892  237 TKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
33-67 2.52e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 58.76  E-value: 2.52e-11
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892  33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
239-273 4.62e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 57.99  E-value: 4.62e-11
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892 239 CPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
276-312 5.40e-11

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 58.03  E-value: 5.40e-11
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 569006892  276 RTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
153-188 1.41e-10

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 56.87  E-value: 1.41e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892  153 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 188
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
154-188 3.60e-10

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 55.68  E-value: 3.60e-10
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892 154 CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 188
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
71-103 4.39e-10

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 55.33  E-value: 4.39e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892    71 TCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
508-547 5.18e-10

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 55.30  E-value: 5.18e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 569006892   508 MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKR 547
Cdd:smart00135   4 LSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
527-564 5.54e-10

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 55.25  E-value: 5.54e-10
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 569006892  527 IYWTDAAS-KTISVATLDGAKRKFLFNSDLREPASIAVD 564
Cdd:pfam00058   3 LYWTDSSLrASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
32-67 9.57e-10

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 54.18  E-value: 9.57e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
72-103 1.18e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 54.13  E-value: 1.18e-09
                         10        20        30
                 ....*....|....*....|....*....|..
gi 569006892  72 CAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
32-64 1.29e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 53.79  E-value: 1.29e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892    32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDE 64
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
238-270 1.61e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 53.79  E-value: 1.61e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   238 KCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDE 270
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
70-103 1.67e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.79  E-value: 1.67e-09
                          10        20        30
                  ....*....|....*....|....*....|....
gi 569006892   70 KTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
550-591 2.16e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 53.37  E-value: 2.16e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 569006892   550 LFNSDLREPASIAVDPLSGFVYWSDWGEPaKIEKAGMNGFDR 591
Cdd:smart00135   3 LLSSGLGHPNGLAVDWIEGRLYWTDWGLD-VIEVANLDGTNR 43
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
592-634 3.39e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 52.99  E-value: 3.39e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 569006892   592 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDR 634
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
278-312 3.45e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 52.59  E-value: 3.45e-09
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892 278 CRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
192-224 3.73e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 52.64  E-value: 3.73e-09
                          10        20        30
                  ....*....|....*....|....*....|...
gi 569006892  192 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
192-224 3.74e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.64  E-value: 3.74e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   192 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
111-149 4.03e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 52.64  E-value: 4.03e-09
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 569006892  111 RTCRINEISCGarSTQCIPVSWRCDGENDCDNGEDEENC 149
Cdd:pfam00057   1 STCSPNEFQCG--SGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
153-185 4.50e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.25  E-value: 4.50e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   153 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDE 185
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
193-224 4.75e-08

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 49.51  E-value: 4.75e-08
                         10        20        30
                 ....*....|....*....|....*....|..
gi 569006892 193 CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
277-309 7.18e-08

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 48.78  E-value: 7.18e-08
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   277 TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDE 309
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
320-350 1.06e-07

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 48.40  E-value: 1.06e-07
                          10        20        30
                  ....*....|....*....|....*....|.
gi 569006892  320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:pfam00057   4 SPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
113-149 2.85e-07

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 47.20  E-value: 2.85e-07
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 569006892 113 CRINEISCGarSTQCIPVSWRCDGENDCDNGEDEENC 149
Cdd:cd00112    1 CPPNEFRCA--NGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
481-521 3.13e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.13e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 569006892  481 QKLFWADLSQKA-IFSASIDDKVgRHFKMIDNVYNPAAIAVD 521
Cdd:pfam00058   1 GRLYWTDSSLRAsISSADLNGSD-RKTLLSEDLQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
613-653 3.52e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.52e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 569006892  613 RLYWLDSKLHM-LSSVDLNGQDRRIVLKSLefLAHPLALTIF 653
Cdd:pfam00058   2 RLYWTDSSLRAsISSADLNGSDRKTLLSED--LQHPNGIAVD 41
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
360-394 4.39e-07

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 46.84  E-value: 4.39e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892  360 CLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTC 394
Cdd:pfam14670   1 CSVNNGGCSHLCLNTPGGYTCSCPEGYKLQeDGRTC 36
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
655-694 4.63e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 46.78  E-value: 4.63e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 569006892  655 DRVYWIDGENEAVYGANKFTGSELATLV-NNLNDAQDIIVY 694
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLsEDLQHPNGIAVD 41
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
320-350 6.63e-07

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 46.09  E-value: 6.63e-07
                           10        20        30
                   ....*....|....*....|....*....|.
gi 569006892   320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:smart00192   3 PPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
320-350 1.05e-06

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 45.66  E-value: 1.05e-06
                         10        20        30
                 ....*....|....*....|....*....|.
gi 569006892 320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:cd00112    2 PPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
396-426 7.07e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.39  E-value: 7.07e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   396 DIDECQNPGICSQ--ICINLKGGYKCECSRGYQ 426
Cdd:smart00179   1 DIDECASGNPCQNggTCVNTVGSYRCECPPGYT 33
exchanger_TraA NF033759
outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large ...
39-293 1.14e-05

outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.


Pssm-ID: 411343 [Multi-domain]  Cd Length: 662  Bit Score: 49.00  E-value: 1.14e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892  39 QCTNGRCITLLWKCDGdedCADGSDeknCVkktCAESDFVCKngqcvpnrwQCDGDPDCEDGSdespeqchmrtcrinei 118
Cdd:NF033759 310 QCPNGRCDLTTNQCRG---CNEDSD---CV---CDEPTFTCV---------ECNTDEQCPNGQ----------------- 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 119 SCGARSTQCIpvswRCDGENDCDNGedeENCGNITCSadefTCSSgrcvsrNFVCNGqDDCDDGSDELDCAPPTCGAhef 198
Cdd:NF033759 355 VCATDLNECR----ECNQDSHCPRG---ESCSNNTCQ----PCST------NDSCAG-NSCNCCPNGTQCAAPTPGA--- 413
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 199 qcsTSSCIPlswvCDDDADCSDQsdeslEQC----GRQPVIHTKCPTSEiQCGSGeCIhkkwRCDGD-PDCKDGSDEVnc 273
Cdd:NF033759 414 ---SPSCVE----CTTDSQCADG-----QRCdtanGRCVDQVPECNTSD-RCGPG-CV----KCPGDrPYCLDGQVCV-- 473
                        250       260
                 ....*....|....*....|.
gi 569006892 274 psrTCRPDqFECEDGS-CIHG 293
Cdd:NF033759 474 ---QCRND-LECGDGQfCLSG 490
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
112-146 1.37e-05

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 42.62  E-value: 1.37e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 569006892   112 TCRINEISCGarSTQCIPVSWRCDGENDCDNGEDE 146
Cdd:smart00192   1 TCPPGEFQCD--NGRCIPSSWVCDGVDDCGDGSDE 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
396-426 3.07e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.47  E-value: 3.07e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 569006892 396 DIDECQNPGICS--QICINLKGGYKCECSRGYQ 426
Cdd:cd00054    1 DIDECASGNPCQngGTCVNTVGSYRCSCPPGYT 33
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
706-749 5.01e-05

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 41.07  E-value: 5.01e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 569006892  706 CEDDmeNGGCEYLCLPAPQindhspKYTCSCPNGYNLEENGREC 749
Cdd:pfam14670   1 CSVN--NGGCSHLCLNTPG------GYTCSCPEGYKLQEDGRTC 36
exchanger_TraA NF033759
outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large ...
32-218 1.43e-03

outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.


Pssm-ID: 411343 [Multi-domain]  Cd Length: 662  Bit Score: 42.07  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892  32 KCDSsqfqcTNGRCITLLWKCDGDEDCADGsdeknCVKktCAESDFVCKNGQ-CVpnrwQCDGDPDCEDGSDESPEQChm 110
Cdd:NF033759 431 RCDT-----ANGRCVDQVPECNTSDRCGPG-----CVK--CPGDRPYCLDGQvCV----QCRNDLECGDGQFCLSGEC-- 492
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 111 RTCRINEiSCGARSTQCIPVSWRC--DGE---NDCDNGEDEENCGNITCSADEFTCS-SGRCV---SRNFVCNGqDDCDD 181
Cdd:NF033759 493 ASCTTDK-RCGPRCEACPGETPFCltDGTvqgSSCVGCRNDADCGSGTCDPTTRTCSnTGACAvtcAEGTVCDG-AACVE 570
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 569006892 182 GSDELDC-APPTCGAHEFQCSTSsciplswvCDDDADC 218
Cdd:NF033759 571 CFADAHCpCGGTCDTATNTCTTS--------CADSGDC 600
NHL_like_5 cd14963
Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) ...
515-681 1.72e-03

Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.


Pssm-ID: 271333 [Multi-domain]  Cd Length: 268  Bit Score: 41.12  E-value: 1.72e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 515 PAAIAVDWVYKtIYWTDAASKTISVATLDGAKRKFLFNSDLRE----PASIAVDplSGFVYWSDWG---------EPAKI 581
Cdd:cd14963   58 PYGIAVDSDGN-IYVADLYNGRIQVFDPDGKFLKYFPEKKDRVklisPAGLAID--DGKLYVSDVKkhkvivfdlEGKLL 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 582 EKAGMNGFDRrplvtEDIQWPNGITLDlVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKS---LEFLAHPLALTIFED-RV 657
Cdd:cd14963  135 LEFGKPGSEP-----GELSYPNGIAVD-EDGNIYVADSGNGRIQVFDKNGKFIKELNGSpdgKSGFVNPRGIAVDPDgNL 208
                        170       180
                 ....*....|....*....|....
gi 569006892 658 YWIDGENEAVYGANKfTGSELATL 681
Cdd:cd14963  209 YVVDNLSHRVYVFDE-QGKELFTF 231
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
401-428 5.41e-03

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 35.29  E-value: 5.41e-03
                          10        20
                  ....*....|....*....|....*...
gi 569006892  401 QNPGICSQICINLKGGYKCECSRGYQMD 428
Cdd:pfam14670   3 VNNGGCSHLCLNTPGGYTCSCPEGYKLQ 30
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
461-499 9.61e-03

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 34.88  E-value: 9.61e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 569006892   461 YIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 499
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLD 39
 
Name Accession Description Interval E-value
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
568-608 1.70e-15

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 70.66  E-value: 1.70e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 569006892  568 GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLD 608
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
237-273 5.23e-12

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 60.73  E-value: 5.23e-12
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 569006892  237 TKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
33-67 2.52e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 58.76  E-value: 2.52e-11
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892  33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
239-273 4.62e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 57.99  E-value: 4.62e-11
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892 239 CPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
276-312 5.40e-11

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 58.03  E-value: 5.40e-11
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 569006892  276 RTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
153-188 1.41e-10

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 56.87  E-value: 1.41e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892  153 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 188
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
154-188 3.60e-10

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 55.68  E-value: 3.60e-10
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892 154 CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 188
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
71-103 4.39e-10

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 55.33  E-value: 4.39e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892    71 TCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
508-547 5.18e-10

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 55.30  E-value: 5.18e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 569006892   508 MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKR 547
Cdd:smart00135   4 LSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
527-564 5.54e-10

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 55.25  E-value: 5.54e-10
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 569006892  527 IYWTDAAS-KTISVATLDGAKRKFLFNSDLREPASIAVD 564
Cdd:pfam00058   3 LYWTDSSLrASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
32-67 9.57e-10

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 54.18  E-value: 9.57e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
72-103 1.18e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 54.13  E-value: 1.18e-09
                         10        20        30
                 ....*....|....*....|....*....|..
gi 569006892  72 CAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
32-64 1.29e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 53.79  E-value: 1.29e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892    32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDE 64
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
238-270 1.61e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 53.79  E-value: 1.61e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   238 KCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDE 270
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
70-103 1.67e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.79  E-value: 1.67e-09
                          10        20        30
                  ....*....|....*....|....*....|....
gi 569006892   70 KTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
550-591 2.16e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 53.37  E-value: 2.16e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 569006892   550 LFNSDLREPASIAVDPLSGFVYWSDWGEPaKIEKAGMNGFDR 591
Cdd:smart00135   3 LLSSGLGHPNGLAVDWIEGRLYWTDWGLD-VIEVANLDGTNR 43
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
592-634 3.39e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 52.99  E-value: 3.39e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 569006892   592 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDR 634
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
278-312 3.45e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 52.59  E-value: 3.45e-09
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 569006892 278 CRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
192-224 3.73e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 52.64  E-value: 3.73e-09
                          10        20        30
                  ....*....|....*....|....*....|...
gi 569006892  192 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
192-224 3.74e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.64  E-value: 3.74e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   192 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
111-149 4.03e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 52.64  E-value: 4.03e-09
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 569006892  111 RTCRINEISCGarSTQCIPVSWRCDGENDCDNGEDEENC 149
Cdd:pfam00057   1 STCSPNEFQCG--SGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
153-185 4.50e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.25  E-value: 4.50e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   153 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDE 185
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
193-224 4.75e-08

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 49.51  E-value: 4.75e-08
                         10        20        30
                 ....*....|....*....|....*....|..
gi 569006892 193 CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 224
Cdd:cd00112    1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
277-309 7.18e-08

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 48.78  E-value: 7.18e-08
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   277 TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDE 309
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
320-350 1.06e-07

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 48.40  E-value: 1.06e-07
                          10        20        30
                  ....*....|....*....|....*....|.
gi 569006892  320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:pfam00057   4 SPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
113-149 2.85e-07

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 47.20  E-value: 2.85e-07
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 569006892 113 CRINEISCGarSTQCIPVSWRCDGENDCDNGEDEENC 149
Cdd:cd00112    1 CPPNEFRCA--NGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
481-521 3.13e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.13e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 569006892  481 QKLFWADLSQKA-IFSASIDDKVgRHFKMIDNVYNPAAIAVD 521
Cdd:pfam00058   1 GRLYWTDSSLRAsISSADLNGSD-RKTLLSEDLQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
613-653 3.52e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.52e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 569006892  613 RLYWLDSKLHM-LSSVDLNGQDRRIVLKSLefLAHPLALTIF 653
Cdd:pfam00058   2 RLYWTDSSLRAsISSADLNGSDRKTLLSED--LQHPNGIAVD 41
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
360-394 4.39e-07

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 46.84  E-value: 4.39e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 569006892  360 CLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTC 394
Cdd:pfam14670   1 CSVNNGGCSHLCLNTPGGYTCSCPEGYKLQeDGRTC 36
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
655-694 4.63e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 46.78  E-value: 4.63e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 569006892  655 DRVYWIDGENEAVYGANKFTGSELATLV-NNLNDAQDIIVY 694
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLsEDLQHPNGIAVD 41
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
320-350 6.63e-07

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 46.09  E-value: 6.63e-07
                           10        20        30
                   ....*....|....*....|....*....|.
gi 569006892   320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:smart00192   3 PPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
320-350 1.05e-06

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 45.66  E-value: 1.05e-06
                         10        20        30
                 ....*....|....*....|....*....|.
gi 569006892 320 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350
Cdd:cd00112    2 PPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
396-426 7.07e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.39  E-value: 7.07e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 569006892   396 DIDECQNPGICSQ--ICINLKGGYKCECSRGYQ 426
Cdd:smart00179   1 DIDECASGNPCQNggTCVNTVGSYRCECPPGYT 33
exchanger_TraA NF033759
outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large ...
39-293 1.14e-05

outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.


Pssm-ID: 411343 [Multi-domain]  Cd Length: 662  Bit Score: 49.00  E-value: 1.14e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892  39 QCTNGRCITLLWKCDGdedCADGSDeknCVkktCAESDFVCKngqcvpnrwQCDGDPDCEDGSdespeqchmrtcrinei 118
Cdd:NF033759 310 QCPNGRCDLTTNQCRG---CNEDSD---CV---CDEPTFTCV---------ECNTDEQCPNGQ----------------- 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 119 SCGARSTQCIpvswRCDGENDCDNGedeENCGNITCSadefTCSSgrcvsrNFVCNGqDDCDDGSDELDCAPPTCGAhef 198
Cdd:NF033759 355 VCATDLNECR----ECNQDSHCPRG---ESCSNNTCQ----PCST------NDSCAG-NSCNCCPNGTQCAAPTPGA--- 413
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 199 qcsTSSCIPlswvCDDDADCSDQsdeslEQC----GRQPVIHTKCPTSEiQCGSGeCIhkkwRCDGD-PDCKDGSDEVnc 273
Cdd:NF033759 414 ---SPSCVE----CTTDSQCADG-----QRCdtanGRCVDQVPECNTSD-RCGPG-CV----KCPGDrPYCLDGQVCV-- 473
                        250       260
                 ....*....|....*....|.
gi 569006892 274 psrTCRPDqFECEDGS-CIHG 293
Cdd:NF033759 474 ---QCRND-LECGDGQfCLSG 490
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
112-146 1.37e-05

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 42.62  E-value: 1.37e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 569006892   112 TCRINEISCGarSTQCIPVSWRCDGENDCDNGEDE 146
Cdd:smart00192   1 TCPPGEFQCD--NGRCIPSSWVCDGVDDCGDGSDE 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
396-426 3.07e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.47  E-value: 3.07e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 569006892 396 DIDECQNPGICS--QICINLKGGYKCECSRGYQ 426
Cdd:cd00054    1 DIDECASGNPCQngGTCVNTVGSYRCSCPPGYT 33
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
706-749 5.01e-05

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 41.07  E-value: 5.01e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 569006892  706 CEDDmeNGGCEYLCLPAPQindhspKYTCSCPNGYNLEENGREC 749
Cdd:pfam14670   1 CSVN--NGGCSHLCLNTPG------GYTCSCPEGYKLQEDGRTC 36
exchanger_TraA NF033759
outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large ...
32-218 1.43e-03

outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.


Pssm-ID: 411343 [Multi-domain]  Cd Length: 662  Bit Score: 42.07  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892  32 KCDSsqfqcTNGRCITLLWKCDGDEDCADGsdeknCVKktCAESDFVCKNGQ-CVpnrwQCDGDPDCEDGSDESPEQChm 110
Cdd:NF033759 431 RCDT-----ANGRCVDQVPECNTSDRCGPG-----CVK--CPGDRPYCLDGQvCV----QCRNDLECGDGQFCLSGEC-- 492
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 111 RTCRINEiSCGARSTQCIPVSWRC--DGE---NDCDNGEDEENCGNITCSADEFTCS-SGRCV---SRNFVCNGqDDCDD 181
Cdd:NF033759 493 ASCTTDK-RCGPRCEACPGETPFCltDGTvqgSSCVGCRNDADCGSGTCDPTTRTCSnTGACAvtcAEGTVCDG-AACVE 570
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 569006892 182 GSDELDC-APPTCGAHEFQCSTSsciplswvCDDDADC 218
Cdd:NF033759 571 CFADAHCpCGGTCDTATNTCTTS--------CADSGDC 600
NHL_like_5 cd14963
Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) ...
515-681 1.72e-03

Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.


Pssm-ID: 271333 [Multi-domain]  Cd Length: 268  Bit Score: 41.12  E-value: 1.72e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 515 PAAIAVDWVYKtIYWTDAASKTISVATLDGAKRKFLFNSDLRE----PASIAVDplSGFVYWSDWG---------EPAKI 581
Cdd:cd14963   58 PYGIAVDSDGN-IYVADLYNGRIQVFDPDGKFLKYFPEKKDRVklisPAGLAID--DGKLYVSDVKkhkvivfdlEGKLL 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 582 EKAGMNGFDRrplvtEDIQWPNGITLDlVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKS---LEFLAHPLALTIFED-RV 657
Cdd:cd14963  135 LEFGKPGSEP-----GELSYPNGIAVD-EDGNIYVADSGNGRIQVFDKNGKFIKELNGSpdgKSGFVNPRGIAVDPDgNL 208
                        170       180
                 ....*....|....*....|....
gi 569006892 658 YWIDGENEAVYGANKfTGSELATL 681
Cdd:cd14963  209 YVVDNLSHRVYVFDE-QGKELFTF 231
NHL_like_6 cd14962
Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) ...
471-574 2.74e-03

Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.


Pssm-ID: 271332 [Multi-domain]  Cd Length: 271  Bit Score: 40.65  E-value: 2.74e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 569006892 471 TVALDADiaaQKLFWADLSQKAIFsasIDDKVGRHFKMIDN-----VYNPAAIAVDwVYKTIYWTDAASKTISVATLDGA 545
Cdd:cd14962   16 GVAADGR---GRIYVADTGRGAVF---VFDLPNGKVFVIGNagpnrFVSPIGVAID-ANGNLYVSDAELGKVFVFDRDGK 88
                         90       100       110
                 ....*....|....*....|....*....|
gi 569006892 546 KRKFLFNSDLRE-PASIAVDPLSGFVYWSD 574
Cdd:cd14962   89 FLRAIGAGALFKrPTGIAVDPAGKRLYVVD 118
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
401-428 5.41e-03

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 35.29  E-value: 5.41e-03
                          10        20
                  ....*....|....*....|....*...
gi 569006892  401 QNPGICSQICINLKGGYKCECSRGYQMD 428
Cdd:pfam14670   3 VNNGGCSHLCLNTPGGYTCSCPEGYKLQ 30
EGF_CA pfam07645
Calcium-binding EGF domain;
396-434 5.87e-03

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 35.41  E-value: 5.87e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 569006892  396 DIDECQNPG-ICSQ--ICINLKGGYKCECSRGYQMDLATGVC 434
Cdd:pfam07645   1 DVDECADGThNCPAntVCVNTIGSFECVCPDGYENNEDGTNC 42
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
461-499 9.61e-03

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 34.88  E-value: 9.61e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 569006892   461 YIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 499
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLD 39
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH